KEGG   Tolumonas auensis: Tola_2450
Entry
Tola_2450         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94045
UniProt: C4L9U2
Position
2674547..2674897
AA seq 116 aa
MSPTWLRPRWLFNRRVARTLLWTMLLLAAAVAANIAGIHYLGSVGGWERWLAEASGYFLL
WRLCLYGATGYGWVWMRRRLLARETGAEAKRRLRRTEIAGVAGIVALEASLLMHAA
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagtccgacctggctgcgcccgcgctggctgttcaaccggcgcgtggcgaggacgctg
ctgtggacgatgctgctgcttgcggcggccgtggcagccaacatcgcgggtatccactac
ctcggcagtgtcggcggctgggaacgctggctcgccgaggcctccggctacttcctgctg
tggcggctgtgcctatacggcgcgacgggctacggatgggtatggatgcgccggcgcctg
ctggcgcgcgaaaccggcgcagaggcgaagcgccgcctccggcgcaccgaaatcgccggc
gtggcgggaatcgtcgcgcttgaggccagcctgctgatgcatgcggcgtag

DBGET integrated database retrieval system