KEGG   Tolumonas auensis: Tola_2451
Entry
Tola_2451         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TraG_N FANCL_d2
Other DBs
NCBI-ProteinID: ACQ94046
UniProt: C4L9U3
Position
2674911..2676431
AA seq 506 aa
MTLFTTDYLEYYLTLLGWIIHNGIWAVLVSSGVFAIPFVAIIIQEWLKARAEGADEGNKG
ALSSVRIENRVWVAIVVVMFAGIPFIDVDLNTIQYDQARSAQCQVSVPQPSDTGWSQSFS
TLNNQSARVPVWWAFMHALSRAITGASVAAIPCGTDLRQIRMEVNATRIDDPVLAQEVAD
FTHDCYGPARAKLFMSRPDLDEAQMHDVTWIGSRYFLDNAGYYDTYRARTPRDGWAYDSN
RDAGLAQVPSGAGYPTCRQWWSDSGNGLRARLLEQVDPSLLNRLAGWAGFLSRAEVDDSV
IRTIASPRQQKLNQGSVYTDYGGQIDKTLPNIINRAASDVGMAVGGLAYFPAMDVVRQAL
PMVLAFLKMALVICIPMVLLIGTYDLKTVVTLTVVQFALFFTDFWLQLARWIDSTILDAL
YGWGWGWNRPHTNFDPLIGLNNTFGDMLLNFVMGAMFLVLPGFWVAALGWVGFRAGHTIQ
GMAEGTKGGAQAGGKGAGAMTGGKLK
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgacgttgttcaccacggattacctggagtattacctgaccctgctgggctggatcatc
cataacggcatctgggcggttctcgtttccagcggcgtgttcgccattcccttcgtggcg
atcatcatccaggaatggctcaaggcgcgtgccgagggtgcggacgaaggcaataaaggc
gcactgtcatcggtacgcatcgagaaccgcgtctgggtggcgatcgtcgtggtgatgttc
gccggtattcccttcatcgacgtcgacctcaacaccatccagtacgaccaggcacgctcg
gcgcagtgccaggtgagcgttccccagcccagcgatactggctggtcgcagtcgttcagc
acgctcaacaaccagagcgcgcgcgtgccggtgtggtgggccttcatgcacgcgctgtcg
cgcgcgatcaccggcgcctcggtcgccgccattccgtgcggaaccgacctgcggcagatc
cgcatggaggtcaatgccacacgcatcgacgaccccgtattggcacaggaagtcgccgac
ttcacccacgactgttatggccctgcacgcgccaagctgttcatgagccgcccggatctc
gacgaggcgcagatgcacgacgtcacctggatcgggtctcggtacttcctcgacaatgcg
ggctactacgacacctaccgggccaggacgccgcgcgacggctgggcctacgacagcaac
cgcgatgccggcctggcacaggtgccgagcggtgccggctatccgacctgccgccagtgg
tggagcgacagtggcaacggcctgcgcgcccgcctgctggagcaggtcgatcccagcctg
ctcaaccgtctggccggctgggccggtttcctcagccgtgccgaggttgatgactcggtg
atccgcactatcgcctcgccgcgccagcagaagcttaaccagggcagcgtctataccgat
tatggcgggcagattgataagacgctgcccaacatcatcaatcgcgccgccagtgacgtc
gggatggcggttggtggactcgcctatttcccggcaatggacgtcgtgcgccaagcctta
cccatggtgctggcgttcctgaaaatggctttggtgatctgtattccgatggtattgctg
atcggcacctacgacctgaaaaccgtcgtcactcttaccgtcgtccagtttgcgttgttc
ttcaccgatttctggctgcaactggcgcgctggatcgacagcacgatcctcgatgcgctt
tacggttggggatggggatggaaccgcccccacacgaattttgaccctctgattgggctg
aacaacacgtttggcgacatgctgctgaacttcgtgatgggagccatgttcctggtgtta
cccgggttctgggtcgcggcgctgggatgggtcggttttcgcgcagggcataccattcaa
ggcatggccgaaggcaccaagggaggcgcacaggctggtggcaaaggcgcaggtgccatg
acgggtggaaaactcaagtag

DBGET integrated database retrieval system