KEGG   Tolumonas auensis: Tola_2452
Entry
Tola_2452         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF3742 FA_desaturase
Other DBs
NCBI-ProteinID: ACQ94047
UniProt: C4L9U4
Position
complement(2676442..2676807)
AA seq 121 aa
MNTTTRSSTAERLGRWLGRGWRGYVRRERRVAAWLVSAGAPNGVATALVWIVKLAVLGVL
LYVAFWLTLLLVFATVAAWASAANTPDEDVWPFTDIDELRNTPGYDPNLYNDNTHVDYKD
D
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaacacgacaacccgtagcagtaccgcagaacgccttggccgctggcttggccgtgga
tggcggggctatgtgcgtcgtgagcggcgggtggccgcgtggctggtgtcggctggtgcg
ccgaacggtgtcgcgaccgctctggtgtggatcgtcaagctcgctgtgctaggggtgctg
ctctacgtggccttctggctgacgctgctcctggtgttcgctaccgtggctgcttgggcc
tcggcagcgaacaccccggacgaagatgtttggcccttcaccgacatagacgagcttcgc
aatacgccgggttatgaccccaatctctacaacgacaacacccatgtcgactacaaggat
gactga

DBGET integrated database retrieval system