KEGG   Tolumonas auensis: Tola_2453
Entry
Tola_2453         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K19155  toxin YhaV [EC:3.1.-.-]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:tau02048]
    Tola_2453
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Tola_2453
Prokaryotic defense system [BR:tau02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YhaV-PrlF
    Tola_2453
SSDB
Motif
Pfam: Toxin_YhaV ParE_toxin
Other DBs
NCBI-ProteinID: ACQ94048
UniProt: C4L9U5
Position
complement(2676835..2677293)
AA seq 152 aa
MQQHGWTLLFHDNLIEQLMKLRAAVLRAQENDPEGFGSNTNVKFFRALVQSMQDVVPGDP
ARDEYRQGNTMGPAYRHWRRAKLGRRYRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDP
YAVFEKMLGRGNPPDEWNALVRASKPDWSKRE
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcaacagcatggctggacgctgctgttccacgacaacctgatcgagcagttgatgaag
ctgcgtgcggccgtgctgcgcgcacaagagaacgacccggagggcttcgggtccaacacc
aatgtcaagttctttcgggccctggtccagtcgatgcaagacgtggtgccgggcgatcca
gcgcgagacgagtaccgccagggcaacaccatggggccggcttatcgccactggcgacgg
gccaagctcggcaggcggtaccggctgttcttccgctacgactcgaaggcgaaggtcatc
gtgtacgcctgggtcaacgacgaacagaccctgcggtcatcggggagcaagtcagacccc
tatgcggtgttcgagaagatgctcggacgcggaaacccgcccgacgaatggaacgcattg
gtaagggcaagcaagccggattggagcaaacgggaatag

DBGET integrated database retrieval system