KEGG   Tolumonas auensis: Tola_2454
Entry
Tola_2454         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, AbrB family
  KO
K19156  antitoxin PrlF
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:tau02048]
    Tola_2454
Prokaryotic defense system [BR:tau02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YhaV-PrlF
    Tola_2454
SSDB
Motif
Pfam: PrlF_antitoxin MazE_antitoxin
Other DBs
NCBI-ProteinID: ACQ94049
UniProt: C4LA74
Position
complement(2677293..2677610)
AA seq 105 aa
MSVIHEVATLTSKGQITLPKSIRQALGVDTGGKVAFDLRDGEVVVTRADAEHEDPAIAAF
LNLLARDIEAGRNVRGLPEDLARTMLEHSGHNVVLGDDFDEDVAI
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtctgtcattcatgaagtcgccacgctgacctccaaaggccagatcacgctgcccaag
tccatccggcaagccctgggtgtggataccggcggcaaggttgcgttcgacctgcgtgac
ggcgaagttgtcgtgacccgtgccgacgccgagcacgaagaccccgccatagccgcgttc
ctgaacctgctggcccgcgatattgaagctggccggaatgttcgtgggctcccggaggat
ctggctcgcacgatgctggagcattcgggccacaacgtggtcctgggcgacgattttgat
gaagacgtggcaatctga

DBGET integrated database retrieval system