KEGG   Tolumonas auensis: Tola_2455
Entry
Tola_2455         CDS       T00904                                 

Definition
(GenBank) Relaxase
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TraI_2 TraI_2_C
Other DBs
NCBI-ProteinID: ACQ94050
UniProt: C4LA75
Position
2677917..2679773
AA seq 618 aa
MLSLFQRKRISVTAAPSPAPAADLPKGLLQPEPAASLLATPRRQKLLEHIWQRTSLSRKQ
FATLYRAPLEHYAELVQQFPASESHHHAYHGGMLDHGLEIIAYALKLRQSHLLPAGAPPE
DQAAQSEAWTAAIAYAALLHDIGKIAVDLHVEYEDGGVWHPWHGPLTRPYRFRYRDDREY
RLHGAATGLLYHQLLDGDVLDWLSGYPALWASLLYVLAGQYEHAGILGELVIQADRASVA
QELGGDPARAMAAPKHALQRKLIDGLRYLLKEELKLNQPQASDGWLTEDALWLVSKTVSD
KLRAHLLSQGIDGIPSNNSAVFNVLQEHGMLQPTPDGKAIWRATVSSEAGWSHSFTLLRL
SPALIWQPAERPEPFAGTVIVEAAAEADTLEQPATGTDDAPSSIRTEADSAHPVARQPPP
EATPADAAMDDLLSLLAVPAQESDGEREQPILDNSAPSIPPTVQPTDTDASPPKRAPEAL
GSTEPSGEHFIAWLQQGIQARRLIINDAKALVHTVADTAYLVSPGLFQRYAQEHPSIAAL
AKQDKVQDWQWIQKRFEKLQLHRKQASGLNIWTCEVTGPRKSRRLHGYLLDDAGLLFSET
PPNNPYLSLSDDTTNISL
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgctctccctgttccagcgaaaacggatctcggtcactgccgctccgtcgccggcaccc
gccgccgatcttcccaaagggctgctgcagcccgagccggccgcgtccttgctggcgacg
ccgcgccggcagaagctgctggaacacatctggcagcgcacatcgctatcgcgcaaacag
ttcgccactttgtatcgcgcaccgctggagcactacgccgagctggtccagcagtttccc
gcttcggagagccatcaccatgcttaccacggcggcatgctcgatcacgggctggaaatc
atcgcctacgcgctcaaactgcgacagtcccacctgctgccggctggcgctccccccgaa
gaccaggcagcccagtcagaagcttggacggcggctatcgcctacgcggcgttgctccac
gatatcggcaagattgccgtcgaccttcacgtcgagtatgaggatggcggcgtttggcac
ccctggcatgggccactgacacgcccataccgctttcgctaccgggatgaccgcgagtac
cgcctgcatggtgccgccacaggattgctctaccatcaactgctcgatggcgacgttctc
gactggctcagtggctaccccgcactgtgggcatcactgctctatgtgctggccggtcag
tacgaacatgcaggcatcctgggagagctcgtcatccaggccgaccgcgcctcggtggcc
caggaactgggaggagatcccgcccgcgccatggccgcacccaaacacgccctgcagcgc
aagttgatcgatggcttgcgttacctgctgaaggaagagttgaagctgaaccagccccag
gcttcggatggctggctcactgaggatgccttgtggttggtcagcaagacagtctctgac
aaactgcgcgcccatctgttgtcccagggtatcgacggcattccctccaacaacagcgcc
gttttcaacgtcctgcaggaacatggcatgctgcagccgacgcccgatggcaaggccatc
tggcgtgccacggtcagcagcgaggccggttggtcacacagctttacgctgttgcggctg
tcgccggcgctgatctggcagccggctgagcggcctgaacccttcgccgggacggtgata
gtggaggcggctgccgaggctgacactctcgaacaaccggcgactggcacggatgatgcc
ccgagcagcatcagaactgaggccgacagcgctcaccctgtcgccagacagccgcctccc
gaagctacgcctgccgacgccgcgatggacgatctgctgtccctgctcgcggtacccgcg
caggagagcgatggcgagcgggagcagcccatcctagacaacagcgccccgtcgatacct
cccaccgtacaacccacggacaccgacgccagtccgccgaagcgggcgcctgaagccctt
ggcagcacggagccgtccggcgagcatttcatcgcctggctccagcaaggcatccaggct
cggcggctcatcatcaacgacgccaaggcgctggtgcataccgtggccgataccgcctac
ctcgtcagtcctggcttgttccagcgttacgcccaggagcacccttccatcgcggcgctc
gccaaacaggacaaggtgcaggactggcaatggatacagaagcgcttcgagaaactgcaa
ctgcatcgcaagcaggccagcggcctgaacatctggacctgcgaggtcactgggccgaga
aaatcccgccgccttcatgggtaccttctggatgatgctggcctgttgttttcggaaacg
ccaccgaacaacccttatctctcgctatcggacgataccaccaacatttctttatga

DBGET integrated database retrieval system