KEGG   Tolumonas auensis: Tola_2457
Entry
Tola_2457         CDS       T00904                                 

Definition
(GenBank) carbamate kinase
  KO
K00926  carbamate kinase [EC:2.7.2.2]
Organism
tau  Tolumonas auensis
Pathway
tau00220  Arginine biosynthesis
tau00230  Purine metabolism
tau00910  Nitrogen metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Tola_2457
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tola_2457
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Tola_2457
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     Tola_2457
SSDB
Motif
Pfam: AA_kinase Asp_Glu_race
Other DBs
NCBI-ProteinID: ACQ94051
UniProt: C4LA76
Position
complement(2680241..2681149)
AA seq 302 aa
MLVVAALGGNALLKRGEPLTARTQRANVRVAAQGLAAIVRAGHDLVITHGNGPQVGLLAL
QGAAFKPDEVYPLDVLGAETEGMIGYVIEQELENALNHDRPVATLLTQVVVDQHDPAFDN
PTKFIGPVYERAEAESRAKTAGWHIAQDGNKWRRVVPSPRPLEIPDMRVIKLLLDQGVVV
ICAGGGGIPILRREDGSTVGIEAVIDKDAASALLAQQLKADALLLLTDVDAIYRDFGKDN
AAAISSLSVEEGRALDLPAGSMGPKLAAAADFAQYGGFSGIGRLEDALGILQGSAGTRIS
AR
NT seq 909 nt   +upstreamnt  +downstreamnt
atgctggtagtcgcagccttgggcggcaacgcccttttgaagcgcggtgaaccgctgacc
gcgcgtacccagcgtgccaatgtgcgggtcgcggcccaaggcttggcggccatcgtgcgc
gctggccatgatctggtcattacccatggcaatggaccccaggtcggtctgctggccttg
cagggcgccgccttcaagccggacgaggtttatcccctggatgtactgggggcggaaacc
gaaggcatgattggctacgtcatcgaacaggagttggagaatgcgctgaatcacgaccgg
ccagtagccacactgctgacccaggtcgtggtggatcagcatgacccggcgttcgataac
ccgaccaagttcatcgggcccgtgtatgagcgggccgaagccgaatcccgggccaaaacc
gccggctggcatattgcccaagatggcaataaatggcgcagggtggtgccgtcacccagg
ccgctggaaatccccgacatgcgggtgatcaagttgctactggaccagggcgtggtggtg
atctgcgcgggtggcggcggcatcccgatattgcgccgcgaagacggtagtacggtgggt
attgaggcggtcatcgacaaggacgcagccagcgccctgctggcgcaacagctcaaggcc
gatgcactgttgctgctgaccgatgtcgatgcgatctatcgggacttcggcaaggacaac
gcagcggcgatcagcagcctgagcgtggaggaggggcgtgccctcgatctgccggccggt
tcgatgggacccaaactggccgctgccgccgactttgcccaatacggagggttcagcggc
attggcagactggaagatgcactgggtattctgcagggaagcgctggcaccagaatatcg
gcgcggtga

DBGET integrated database retrieval system