KEGG   Tolumonas auensis: Tola_2458
Entry
Tola_2458         CDS       T00904                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
tau  Tolumonas auensis
Pathway
tau00220  Arginine biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01230  Biosynthesis of amino acids
Module
tau_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Tola_2458
Enzymes [BR:tau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Tola_2458
SSDB
Motif
Pfam: OTCace OTCace_N
Other DBs
NCBI-ProteinID: ACQ94052
UniProt: C4LA77
Position
complement(2681151..2682152)
AA seq 333 aa
MAFNLKSRHFLTLRDFSPREISYLLKLAGDLKAAKYTGTEVPQLCGKEIALIFEKDSTRT
RVGFEVAAFDQGAKVTYLGPTGTHIGHKESVKDTARVLGRVYDAIEYRGFGQAVVEELAE
YAGVPVYNGLTDEFHPTQILADFLTMQEHVEKPLRDMSYVFIGDAANNMGDSLLIGGAKM
GMDVRLCAPRACWPHDDIQQEAQRIASTTGARITITEDIDSAVAGVDFVYTDVWVSMGEP
EEKWAERIKLLLPYQVNSALMEKTGNPRVHFMHCLPAFHNTETTVGKEIQQKFGIDAMEV
TEEVFESPASIVFDQAENRMHTIKAVLVATLGA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggccttcaatctgaaaagccgacactttctcacgctgcgggacttcagtccgcgcgaa
atcagttacctgctgaaactggcaggcgacttgaaagcagctaagtataccggcaccgaa
gtgccgcagttgtgcggtaaggaaatcgctctgatctttgaaaaggactccactcgcacc
cgggtaggcttcgaggttgcggcctttgatcagggcgccaaggttacctatcttgggccg
accggcacccatattggtcacaaagaatcggtcaaggacaccgcccgagtgctggggcgc
gtctatgatgccatcgaataccggggcttcggccaggctgtggtcgaggagttggccgag
tatgctggcgtgcccgtctacaacggcttgacggatgaatttcatcctacccagatcctg
gctgacttcctgaccatgcaggagcacgtggaaaagccactgcgagacatgtcctatgtc
ttcatcggcgatgccgccaacaacatgggtgacagcctgctgatcggcggcgccaaaatg
ggcatggacgtacgcctatgcgccccgagggcctgttggccgcatgatgatatccaacag
gaagcccagcgaatcgccagcaccactggcgcccggatcacgatcaccgaggatatcgac
agtgcggtagccggtgtggatttcgtctataccgatgtttgggtgtccatgggcgagccc
gaggaaaaatgggccgagcggatcaagctgctgctgccctatcaggtcaatagcgcactc
atggaaaaaaccggcaacccgcgggtgcacttcatgcattgcctgccggccttccacaat
accgagaccaccgttggcaaggagattcagcagaagttcggtatcgatgcgatggaagtc
accgaggaggtcttcgaaagccccgcctcgatcgtcttcgatcaggcggaaaaccgtatg
cacaccatcaaggcggtgctggtcgccaccctgggagcctga

DBGET integrated database retrieval system