KEGG   Tolumonas auensis: Tola_2459
Entry
Tola_2459         CDS       T00904                                 

Definition
(GenBank) Arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
tau  Tolumonas auensis
Pathway
tau00220  Arginine biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Tola_2459
Enzymes [BR:tau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     Tola_2459
SSDB
Motif
Pfam: Amidinotransf
Other DBs
NCBI-ProteinID: ACQ94053
UniProt: C4LA78
Position
complement(2682171..2683400)
AA seq 409 aa
MSEHTLGVHSETGILRQVIVCRPGLAHRRLTPSNCDALLFDDVFWVKQAQKDHDVFVSLM
RARGVEVLDVNQLLAETLDIAEARSWILDHRISWNHIGVGMVSDLRAWMDELPGHVLAEF
LIGGLQVNDLPFDPSGLFGNHLGPYGFILPPLPNFLFTRDNSSWIYGGVTLNPMYWAARK
PETLLTAAIYQFHPKFSGKVEVLWGDPLKDHALATLEGGDIMPIGNRTVLVGMGERSSPQ
AIGQLANALFEHGTVDRVVACQIPKSRAAMHLDTVFTFCGGNVVTAFTEVADQMVCYDLR
PGAGGKHLTFNQDPRPMFDVVAEALGYQSLTVIPTGGDTPAEREREQWNDGNNVLALSPG
VVIGYDRNDDTNAALESAGIEVLKVPGAELGRGRGGGRCMSCPTIRDAI
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtctgaacatactcttggcgttcactccgaaacaggtattttgcggcaggtcatcgtt
tgtcgccccggtcttgcccatcgcaggctaacgcccagtaattgtgatgctctattgttt
gatgatgtgttctgggtcaaacaggcgcaaaaggatcacgatgtattcgtaagtctgatg
cgtgcccgaggagtggaggtgttggatgtcaatcaactgctggccgagaccctggacatc
gccgaagcacgaagctggattctcgatcatcggatcagctggaatcatattggcgtcggc
atggtgtctgatttgcgggcctggatggacgagctgccagggcacgtcctggcagagttc
ctgatcggtggcttgcaggtgaatgatctgccgttcgatccgagcggtctgttcggcaac
cacttggggccttatggctttatcttaccgcctctgccgaattttctatttacccgagac
aacagctcctggatctacggtggcgtcacgctgaatcccatgtactgggccgcacgcaag
ccggaaacgctgctgacggcagcaatctaccagtttcatccaaaattttccggcaaggtc
gaggtgctctggggagatccgctcaaggatcacgcactggcaaccctggaaggcggcgac
atcatgccgatcggcaatcgcaccgtgttggtcggcatgggcgagcgttcgtccccccaa
gcgatcgggcagctggctaatgccctgttcgagcacggcacggtcgatcgcgtagtggcc
tgccagattcccaaaagccgggcggccatgcatctggatacagtgttcacgttctgtggt
gggaatgtcgttactgccttcacagaagtggctgatcagatggtctgttatgacctgcgg
cccggcgcgggcggcaagcacctgacgttcaaccaggatccgcgtccgatgttcgacgtg
gttgcggaggcgctcggttatcaatctctgaccgtgatccctaccggaggggacacgccc
gccgaacgtgagcgcgagcagtggaatgatggcaacaacgtactggccctgagcccgggc
gtcgtcattggctatgaccgcaatgacgacaccaacgctgctctggaatcggccggcatc
gaagtgctgaaagtaccaggcgcagagctaggccgggggcgcggcggtggacgctgcatg
agctgcccaaccatacgcgacgcaatctga

DBGET integrated database retrieval system