KEGG   Tolumonas auensis: Tola_2460
Entry
Tola_2460         CDS       T00904                                 

Definition
(GenBank) C4-dicarboxylate anaerobic carrier
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DcuC Membralin
Other DBs
NCBI-ProteinID: ACQ94054
UniProt: C4LA79
Position
complement(2683425..2684870)
AA seq 481 aa
MAEESASAQNLEQDLTSRFPTAYTILLLLIVLIAALTWIIPAGKYERVMNEEVGREVAVP
GTYQVVESSPQGFMDVLLAPTAGFYDPDSYVANAVDVALFILFLGGFLGVVNATGSIDTG
IRSAMQRLEGREIWMIPILMTLFALGGTTYGMAEETLAFYVILIPIIIAAGYDAVTGVAV
ILIGSGIGVLGSTINPFATVIASNAAHIPFTDGLLLRLVLLIGGLVICAVYVMRYAKRVK
ADPSRSVVAKQRNAHRTLFLQGHDDLGDVKLSLTQKLVLVIFALTFVVMIWGVSSQDWWM
DKMGALFLAAAIVVGVVARLGEKRLAGSFVDGARDLLGVALVVGLARGIVVIMEQGMIAD
TILHSAEMRLSNMSELGFINLMFWIETGMSFLVPSSSGLAVLSMPILAPLADFANVSRDL
VVTAYQSANGLVNLINPTFAVVIGGLAIGRVSYDRWLVFIWPLMAILTLFITLVISIGVF
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctgaagaaagcgcttccgcgcaaaacctagagcaggatctgacaagtcgctttcca
acggcttacaccattctgcttttgttgatcgtcttgattgctgcgctgacttggatcatt
cccgccggaaagtatgagcgggtcatgaatgaagaggtcggccgcgaagtggctgtgcct
ggcacttaccaagtggtcgagtccagcccccaggggtttatggacgttctgctggcgccc
actgcgggtttttatgatccagacagctatgtcgccaacgccgtggatgtagcgctgttc
atactatttctcggtggttttttgggcgtagtgaatgccaccggctcgatcgacaccggt
attcgcagcgcaatgcagcggttggagggccgagagatctggatgatcccgatcctgatg
actttgttcgcccttggcggcacaacctatggcatggctgaagagaccctggcgttctat
gtcattttgatcccgatcatcatcgccgccggctacgatgccgtgacgggggtggctgtg
atcctgatcggctcaggcatcggtgtattgggctcgaccatcaatccctttgccactgtg
atcgcctccaatgcagcccacattccttttaccgatggcctgctgctgcgcctagtgctg
ctgattggcggtttggtgatctgtgccgtctatgtgatgcgctatgcaaaacgggtcaag
gccgacccttcgcgttccgtcgtggccaaacaacgcaatgcccaccgcacgttgtttcta
caggggcatgatgatctgggtgacgtcaaactgagcctgacccagaaactggtactagtg
atcttcgccctgaccttcgtggtcatgatctggggtgtttcctcccaggactggtggatg
gacaagatgggcgctctgttcctggccgctgcgatcgtcgttggtgttgtcgcccgcctg
ggcgagaagaggctggccggcagctttgtcgatggcgcccgtgatctgcttggcgtagct
ctggtcgttggcctagcgcgaggcatcgtggtcatcatggaacagggcatgattgctgat
acgattttgcacagtgctgaaatgcgcttgagcaacatgtcggaactgggtttcatcaac
ctgatgttctggatcgagacgggcatgagcttcctcgtgccttcgtcatccggccttgcg
gtactgtcgatgcccattcttgcccccctggcggactttgctaatgtcagccgcgactta
gttgtaactgcctatcaatcagccaacggcctggtgaatctgatcaacccaaccttcgca
gtggtgatcggcggcctggccatagggcgagtctcctatgaccgctggctggtattcatc
tggcccttgatggcgattctgaccctgtttatcaccttagtgatcagcatcggtgtcttc
ctgtaa

DBGET integrated database retrieval system