KEGG   Tolumonas auensis: Tola_2461
Entry
Tola_2461         CDS       T00904                                 

Definition
(GenBank) Protein of unknown function DUF676 hydrolase domain protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Abhydrolase_6 PGAP1 DUF676 Hydrolase_4 Abhydrolase_1 Lipase_3 Abhydro_lipase Abhydrolase_5
Other DBs
NCBI-ProteinID: ACQ94055
UniProt: C4LA80
Position
complement(2685394..2687337)
AA seq 647 aa
MRFQQSCRMAVWLVIAPLLLGGCSILREFGPVVEVHTLDAGEAIELKRGDILTRGKLSDA
TTQTIRVAALDAQACAKPISADCVEALAAVTGVAADRRLAALSELWLAQAQAMKPGSEQQ
AAWLETIRYAYAYLFFGDHTPGERAFEDRQTQVRDWYNYAVERAATGMFEVRQQMSTQLS
AQTRWNIAGWELQLDMRSARLPGSTAVPAELLPASSLSFRGLRSLYRRDGFGAELVAVMP
DEPLTSAPTRDGHPAAKRNQQPLPWSEMPAPSMTILLHPDGDDLDSVLHTRTVRLTVHDP
YVESAIMLRGQRVPLAANFTAGYGLWLARANFNRQSLRSLLGREGGIDRPHVYLMQPYDP
NRRIIVMLHGLASSPEAWVELANEILGDEALRQHYQIWQVYYPTNMPIALNHAMIRRALG
DTLAHFDPSGQAPASSDLVLVGHSMGGVIARLMVSSTDQSLVQLAADRSRLTPQQIKRID
PMLRFEPFPHVSRAIFIAAPHRGTSVAGGRLGRWMAGFIRFPVTVLEELAHTLAPNAAAS
SHESLGHIPNSVDNLDENDPFVRAAADFPISAQVNYHSIVAQANAEEALVDSDDGLVPYR
SSHLPGAQSEKVIISGHSVQQSAVAILEIQRILKEDMTQREEQLTPR
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaggttccagcagtcttgccgcatggcagtgtggctcgtcattgccccgctgttgctg
gggggctgctcgatcctgcgtgagttcggcccagtggttgaggttcatacactggatgcg
ggcgaggccatcgaactcaagcgcggcgatatcctgacacgcggcaaactcagcgatgcg
acgacccagaccatcagggtggcggcattggatgcgcaggcttgcgcaaaaccgatctca
gcggattgcgtcgaggccctggccgccgtgaccggcgttgccgcggatcgacgcctggct
gcactgtccgaactgtggctggcgcaggctcaggccatgaagcccggatcagagcagcaa
gccgcctggcttgagaccattcgttatgcctatgcctacctgttcttcggtgaccatacg
cctggggagcgagccttcgaggatcgccagacgcaagtgcgggattggtataactatgcg
gtcgaacgtgccgccaccgggatgttcgaggttcggcaacaaatgtctacgcagttgtca
gcgcagacccgctggaacattgcaggctgggagctgcagctggatatgcgcagcgcgcgc
ttgccgggcagtacggcggtgccagccgaactcctgccagcctcgtccctgtctttccgc
ggactgcgcagcctctaccggcgcgacggtttcggcgccgagttggtggcggtcatgccg
gacgaacccctgacttccgcccccacccgggatggccatccagcggccaaacgcaatcag
cagcctctaccctggagcgagatgcccgcgccgtccatgacgattctgctgcacccggac
ggagacgacctggacagcgtgctgcatacccgcactgtccgtttgacggtgcatgacccc
tatgtggagtcggccatcatgctgcgcgggcagcgcgtaccgctggcggccaatttcacc
gccggctacggactgtggctggcccgcgccaacttcaaccggcagtcgctgcgcagcctg
cttgggcgcgagggtggaatcgaccgtccgcacgtctacctgatgcagccctacgatccg
aaccgacggatcatcgtcatgctgcacggactggccagtagcccggaagcctgggtggaa
ctcgccaacgaaatcctgggcgatgaggcgctgcgccagcattaccaaatctggcaggtc
tactacccgaccaatatgccgatcgcattgaaccacgcgatgattcgcagagcgctcggg
gatacgctggcgcatttcgatccttccggccaggcgccggcatcgtccgaccttgtactg
gtggggcatagcatgggcggggtcatcgcgcggttgatggtgtcgtcaaccgaccagtcg
ctggtgcagctggctgcggatcgcagtcggctgacgccgcagcagatcaaacgcatagat
ccgatgttgcgtttcgagcccttcccgcatgtcagccgcgccatcttcatcgcagcaccg
caccggggcacgtcggtcgcaggtggacgcctggggcgctggatggcgggattcattcgc
ttccccgttacggtgctcgaagaactcgcccacacactagcacccaatgcggcggccagc
agccacgaaagcctggggcatatccccaatagcgtcgacaacctcgacgagaacgatcct
ttcgtgcgcgcggcggcggactttcccatctctgcccaggtgaactatcactcgatcgtg
gcccaggctaatgccgaagaggccctcgttgattctgatgatggtcttgtgccttaccgc
agctcccacctgcccggcgcgcagtccgagaaagtcatcatttcggggcacagcgtgcaa
cagagcgcggtcgcaatattagagatccagcgtattctgaaagaggatatgacgcagcgg
gaagagcagctcaccccgcgctag

DBGET integrated database retrieval system