KEGG   Tolumonas auensis: Tola_2462
Entry
Tola_2462         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF4105 LBP_M
Other DBs
NCBI-ProteinID: ACQ94056
UniProt: C4LA81
Position
complement(2687334..2688377)
AA seq 347 aa
MSKVRQKARHLPVRLVTGVAVLLLTAWGALALWHQVPQPAVRWFTLALWAAAGLSMVAAL
TGLLSRKSCNFTAVVFVSAVAILAAWWSTLQPSHHRLWADDVAQLLEARIDGDHVQLKNV
RNFEWRSETDYTPRWENRTYDLTRLRSADLVLSYWMGPHIAHTLVSFGFDGGERVVFSLE
IRKERHESFSAIGGFFRQFEQILVAADERDIVRTRSNARGEAVYLYRLQMSQANVRALFL
EYLHAANELRRTPRFYNTLTSNCTTIVFELARLIAPALPADYRLLLSGHFAEYIHDLHGL
TPGHRYAELQALGHINERALASDASGDDFSMSIRQGVPGVPADEVSP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagcaaggtaaggcaaaaagccagacacctccctgtgcgactggtgaccggggttgcg
gtgctactgctgactgcatggggtgcactggctctatggcatcaggtgccgcagccggct
gttcgctggttcaccctcgcgctgtgggcggccgcgggactgtcgatggtggcggcgctg
acaggtctgctcagccgcaagtcatgtaatttcacggcagtggtattcgtaagcgccgtc
gctattctggcggcgtggtggagcaccctgcagccctcgcaccaccgcctatgggctgac
gatgtcgcccagttgctggaggccaggatcgacggcgatcatgttcaactgaaaaatgta
cgcaacttcgaatggcgcagtgaaaccgattacacgccgcgttgggagaaccgtacctac
gaccttacccgcctgcgtagcgccgatctggtactttcctactggatggggccgcacatt
gcgcacacactggtgtcgttcggcttcgacggtggcgagcgggtggtgttctcactggaa
atacgcaaggagcgccacgagtccttctcggcgatcggcggattcttccgtcagttcgag
cagatcctggtagccgccgatgagcgcgacattgtgcgtacgcgcagcaatgcgcgaggc
gaggccgtttatctctatcggttgcagatgagtcaggcgaatgtccgcgcgttgtttctg
gagtatctgcacgcggccaatgaactgcggcgcacaccgcgcttttacaacaccttgacc
agtaactgcacgaccatcgtattcgagctggctcggctcattgcgccagcgttgccggcg
gactatcgcctgctgctgtccggacactttgcggaatacatccatgacctgcacggattg
acgcccggccatcgctacgcagaactgcaggcactggggcacatcaacgaacgcgcactg
gcctctgacgcatcaggagacgacttctcgatgtcgattcgacaaggtgtgcccggcgtg
ccggccgacgaggtatctccatga

DBGET integrated database retrieval system