KEGG   Tolumonas auensis: Tola_2463
Entry
Tola_2463         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: TetR_N TetR_C_11 TetR_C_7 DUF2887
Other DBs
NCBI-ProteinID: ACQ94057
UniProt: C4LA82
Position
complement(2688377..2689009)
AA seq 210 aa
MPTNKDDVPGKRRYLSSVARREEILDAALIEFADRTYNAVSMERLAECAGLSKAGIYAHF
KSKEEIFHALLERTTKQICDFQGWLPDEDLTLPELVDVYLDRLYATFSSPATMSIYRLLL
AESARTPELVQRWHNEVAHGLKERAQLIIQRNIERGIIRPGVLTEHFFPLALAPALLWLN
SSMLSRGNPSIELVQVRDAHRQLLLELLQP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaaccaacaaagacgacgtaccaggcaagcgccgctatctgtcttctgtggccagg
agagaggaaatattggatgcggcgttgatcgagtttgcggatcggacatacaacgccgtg
tcaatggagcgcctggcggaatgcgcaggcttgtccaaggctggtatctacgcccacttc
aaaagcaaggaagaaatttttcatgccttgctcgaacgcacgacaaagcagatttgcgat
ttccagggctggctcccggatgaagatctgacgttgccagagctggtagatgtctacctg
gatcgcctatacgcgacctttagctcccctgccacgatgtcgatttaccggctgcttctg
gccgaaagcgccagaacaccagagctggtgcagcgttggcacaacgaagttgctcacgga
ctgaaagagcgggcgcagctcatcatccaacgcaacatagaacggggcatcattcgtccg
ggtgtcttgaccgagcactttttcccgctggcgctcgctcccgcactgctatggctgaac
tcgtcaatgctatccaggggaaacccttccatagagctcgtgcaggtacgagatgcgcat
cggcagctgctgcttgagctcttgcagccttga

DBGET integrated database retrieval system