KEGG   Tolumonas auensis: Tola_2464
Entry
Tola_2464         CDS       T00904                                 

Definition
(GenBank) RND efflux system, outer membrane lipoprotein, NodT family
  KO
K18139  outer membrane protein, multidrug efflux system
Organism
tau  Tolumonas auensis
Pathway
tau01501  beta-Lactam resistance
tau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tola_2464
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Tola_2464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2464
   01504 Antimicrobial resistance genes [BR:tau01504]
    Tola_2464
Transporters [BR:tau02000]
 Other transporters
  Pores ion channels [TC:1]
   Tola_2464
Antimicrobial resistance genes [BR:tau01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    Tola_2464
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    Tola_2464
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    Tola_2464
SSDB
Motif
Pfam: OEP DUF1707 DUF2161
Other DBs
NCBI-ProteinID: ACQ94058
UniProt: C4LA83
Position
2689453..2690940
AA seq 495 aa
MPPAFPLLSEFKLRTASLALSAVVLTGCMSLAPAPDTPPLPVPEVWPGHLESSTEGAHAG
ELAWQAYFTDPLLQRLIETALENNRDLRLAALRVEEASAAFRIQRSDRFPAVGVGAQGGR
ARVPGDLNMSGRSQVGGEYRAEVGLSTWELDLWGRVRNLEDAALQRWLASDAARQAVHLA
LIAQVADGYLGLREIDERVAIARQTVATREESYRIFRRRVEVGSTSKLDLTQVQTLLNQA
QALLTQLEQARATQLHALALLVGADPGPLPTKAPFDETTVLAELRTGLPSELLVSRPDII
AAEHQLRAGDANIGAARAAFLPRIALTGSFGTASSDLDGLFDSGSRAWTFMPTLSLPIFD
GGRRRANLELSEVRRDIAVAGYEKTIQTAFREVADALSAKYWLAEQLTIQRANLEAQSER
ARLAQLRYDNGSAAFLEVLDAQRDLLDAGQQLVQARRALLSSQVALYAALGGGTLTATGQ
AQSATSTPASTPSTR
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgcctccagcttttcctttattgtctgagttcaaattgcgcactgcctcgctggcactg
agcgccgtcgtactgaccggctgcatgtcgctcgctcctgctcctgataccccgccgctg
ccggtacccgaggtttggcctggtcatcttgaatcgagcaccgagggtgcccacgcggga
gaacttgcctggcaggcctacttcacggaccctttgctgcaacgcctcatcgagaccgcg
ctggagaacaaccgcgatctgcgcctggccgcgctgcgtgtcgaggaagccagcgccgca
ttccgcattcagcgctcggatcgatttcctgccgtgggcgtgggtgcccagggtggacgc
gcccgcgtccctggcgatctgaacatgtcgggccggtcgcaggtgggcggcgaatatcgg
gccgaggtgggtttgagcacctgggagctggatctgtggggccgggtccgcaacctggaa
gacgccgctctgcaacgctggctggcttccgacgcggcccgccaggccgtccacctggcg
ctaatcgcccaggtggccgacggttatcttggcttgcgcgagatagacgaacgcgtggct
atcgcccgtcaaaccgtcgcgacccgcgaggagtcctatcgcattttccggcgccgcgtt
gaagtcggctcgacctcgaagctggacctcactcaagtccaaactttgctgaaccaggct
caggcgctgctaacccagcttgagcaagcacgcgccacgcaactgcacgcgctggcactg
ctggtaggtgccgatcctggcccgctgcccaccaaggcacccttcgatgaaacaacggtg
ctggccgaacttcggaccggtctgccttcggaactgctggtcagtcgtccggacatcatt
gccgccgaacaccaattgcgcgctggcgatgccaacatcggggccgcccgcgcggcgttc
ttgccgcgcattgcgctgaccggcagcttcggcacggccagttccgatctggacggcctg
ttcgattccggcagccgcgcctggaccttcatgcccaccctgtcgctgcccatcttcgat
ggcgggcggcggcgcgccaacctggaactgagcgaagtgcgtcgtgacatcgccgttgcc
ggctacgagaagaccattcaaacggcctttcgcgaggtggccgatgcactgagcgccaag
tactggctggctgagcaattgacgatccagcgggccaatctggaagcgcaaagcgaacgc
gcgcggctggcccagttgcgctacgacaacggctcggccgctttcctggaggtgctggac
gcccaacgcgatctgctggatgccggacaacaactggtgcaggcgcgccgtgcgctgctg
tctagccaggtggcactgtatgccgcgctcggcggcggcaccctcaccgcaaccggccag
gcgcagagtgcgacctcgacgcccgcttccaccccatcaacccgttaa

DBGET integrated database retrieval system