KEGG   Tolumonas auensis: Tola_2465
Entry
Tola_2465         CDS       T00904                                 

Definition
(GenBank) secretion protein HlyD family protein
  KO
K01993  HlyD family secretion protein
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Tola_2465
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD Biotin_lipoyl OEP Peptidase_M23 Fez1 KH_2 PTS_EIIA_1 HrpB7 Spc7
Other DBs
NCBI-ProteinID: ACQ94059
UniProt: C4LA84
Position
2690955..2692034
AA seq 359 aa
MTVSPSLKKKLLVAAAAAVVVALAWWGWTKFADTGPGEGFVNGNGRIEATEIDIATKLPG
RIEDILVREGDFVSAGQPLARMQLETLEAQRDEAFAMREQAEHSVTAAQAQVALREADVV
AAQALVGQRESELDAAQRRLKRSQTLSQEGAASIQELDDDRARVRGAQATLAASKAQTAA
ARAAVEAAKAQLVGARSSVSAATASINRIEADIRDSELRSPRDGRVQVRVAQPGEVLGSG
GRVLNLIDLSDVYITFFLPETVAGRVALGSEVRIILDAAPEYVIPATVSFVASAAQFTPK
TVETASERQKLMFRVRAQISQELLREHLQQVKTGLPGVAWVKLDANAEWPQNLSLRVPE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactgtctccccctctctcaagaaaaaactcctggtcgctgccgctgcagcggttgtt
gtcgcgctggcctggtggggctggacgaagtttgccgataccggccccggcgaaggattc
gtcaacggcaatggccgcatcgaagccacggagatcgacatcgccaccaagctgcccgga
cgtatcgaagacattctggtccgtgaaggcgatttcgtctcagcgggccagccactggcc
aggatgcaactggaaacgcttgaggcgcagcgcgacgaagctttcgccatgcgtgaacag
gccgagcactcggtgaccgcagcacaggcccaggtggcgctgcgtgaagccgacgtggtt
gcggcgcaggcactcgtcggccagcgcgagtcggagctcgatgccgcgcaacggcgactg
aaacgttcgcagacattatcccaagaaggcgccgcctcgatacaagagttggacgatgac
cgggcgcgcgtgcggggcgcacaggcgacgctcgcggccagcaaagcacagaccgccgct
gcccgcgccgcggtcgaggccgccaaggcgcagctcgtaggcgcgaggtccagcgtgtcc
gctgccacggccagcatcaaccgcatcgaagccgacatacgcgacagcgaactgcgctcg
ccgcgtgacggtcgggtgcaggtgcgggtggcgcaacccggcgaggtgctgggatcgggc
ggacgcgtcctgaacctgatcgacctgtcggacgtctacatcaccttcttcctgcccgag
accgtggccggccgcgtcgcgctgggttccgaggtccgcatcattctggatgccgcgccg
gagtatgtgataccagccactgtttccttcgtcgccagcgcggcgcagttcacccccaaa
acggtcgaaaccgccagcgagcggcagaagctgatgttccgcgtgcgcgcgcagatttcg
caggagctgctgcgtgaacacctgcagcaggtcaagaccggtttgcccggcgtggcctgg
gtcaagctcgacgccaatgccgagtggcctcaaaacctgtcccttcgcgtgccggagtaa

DBGET integrated database retrieval system