KEGG   Tolumonas auensis: Tola_2466
Entry
Tola_2466         CDS       T00904                                 

Definition
(GenBank) ABC transporter related
  KO
K13926  ribosome-dependent ATPase
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    Tola_2466
SSDB
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4 AAA_16 AAA_29 RsgA_GTPase MMR_HSR1 Rad17 AAA_23 VKG_Carbox
Other DBs
NCBI-ProteinID: ACQ94060
UniProt: C4LA85
Position
2692038..2694806
AA seq 922 aa
MSHSASVQPTTVASVRQVRLRYGDVIALDGIDLDIPAGRMVGLIGPDGVGKSSLLSLLAG
VRIIQEGTVEVLGGDMASKAHRNKVCPRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHG
AAERRQRIDELTQATGLFKFLERPAGKLSGGMKQKLGLCCALIHDPDFLILDEPTTGVDP
LARAQFWDLIDRIRADRPGMSVIVATAYMDEAQRFDWLAAIDDGKVLATGTPKELLARTG
SPNLEEAFIRLLPEEKKRGHQAVVIPPLSDGGADDIAIEAEGLTMRFGDFVAVDSVSFRI
RRGEIFGFLGSNGCGKSTTMKMLTGLLPASEGRAWLFGHEVDPHDLDTRRRVGYMSQAFS
LYSELTVRQNLELHAKLFSVSPNDIPGRVDEMVERFGLADVIDSLPASLPLGIRQRLSLA
VAMVHKPELLILDEPTSGVDPVARDAFWRLLIELSRRDRVTVFISTHFMNEAERCDRMSM
MHAGKVLDSDVPARLVEKRGAKTLEEAFIGYLVEAEGGTAAPASQPGAADHEEQPSAAPA
EHGGHGSGGFSLQRMFSYLWRETLELQRDPVRATLALGGSLLLMFVIGFGITMDVEDLSY
AVLDRDQTTLSQSYTLNLAGSRYFTEHAPIIDYDDLDRRMRSGELSLAIEIPPGFSRDVL
RGQNVQIGAWLDGAMPQRAETVQGYVQGMHQHWLLVQASERGGASAAGNASVETRFRYNP
DVKSLPAMVPAVIPLLLLMLPAMLTALAVVREKETGSITNLYVTPVTRIEFLLGKQLPYV
GLAMVNFLLMSLLAVTVFGVPVTGSFFTLSLAALIFSFAATGMGLLASAVTRSQIAAMFF
AMIGTIIPATQFAGLIDPVSSLEGSSKFIGEIYPATHMISISRGVFSKALGLADLAGPLW
SMLLSVPVILGAAVLLLKKQER
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgagccacagtgcgagtgtgcagcccacgaccgttgcaagcgtccgtcaggtgcgcttg
cgctacggcgacgtcattgccctggatggcatcgacctggacattcccgccgggcggatg
gtcggcctgatcggccccgacggcgtgggcaaatccagtctgctctcattgctggcgggt
gtgcgcatcatccaggagggcacggtcgaggtgctgggtggcgacatggccagcaaggcc
catcgcaataaagtgtgcccgcgcatcgcctacatgccgcagggactgggcaaaaacctg
tatccgacgctctcggtcgaggagaatctgcaattcttcgcgcgcctgttcggtcatggc
gccgcagagcgccgccagcggatcgatgagctcacccaggccactggcctgttcaaattc
ctggagcgcccggcaggcaagctgtccgggggcatgaagcaaaaactcggcctgtgctgc
gcgctgattcatgacccggattttctgattctcgatgagccgacgactggcgtggacccg
ctggcgcgcgcgcagttctgggatctgattgaccgtatccgcgccgatcgccccggcatg
agcgtgattgtggccacggcctacatggatgaggcccagcgcttcgactggctggccgcc
atcgacgacggcaaggtcctcgccaccggcacgccgaaggaattgctggcaagaacaggc
agcccgaacctggaagaggcattcatccgcctgctcccggaagagaaaaagcgcggacac
caagcggtagtcattccccccttgtcggatggcggcgcggacgatatcgccatcgaggcc
gaggggctgaccatgcgctttggcgacttcgttgccgtcgatagcgtgtccttccgtatc
cggcgcggtgaaatcttcggcttcctcggctccaatggttgcggcaagtccacgaccatg
aagatgctcaccggcctgctgccggcgagcgagggccgggcctggctgttcggccacgaa
gtcgatccgcatgacctggacacccgccgccgtgtcggctacatgtcgcaggcgttctcg
ctctacagtgaactcacggtacgccagaatctggagttgcacgccaagctgttcagtgtg
tccccgaacgatattccgggccgcgtggacgagatggtggagcgctttgggctggcggac
gtcatcgacagcctgccggccagtctgccgctgggcatacgccagcgcctgtcgctggcc
gttgccatggtgcacaagcccgagctgctgattctggacgaaccgacttcgggcgtcgac
ccggtggcgcgcgatgcgttctggcgactgctcatcgagctgtcgcggcgtgaccgggtg
acggtcttcatttccacccacttcatgaacgaggcagagcgctgcgaccgcatgtcgatg
atgcatgcgggcaaggtgctcgacagcgacgtgcccgccagactggtcgagaagcgcggc
gccaaaacccttgaagaggccttcatcggctacctcgtcgaagccgagggcggcacggcg
gcgccggccagccagcccggggccgccgatcacgaggagcaaccatcggcggcgcccgct
gaacacggcgggcacggctctggcggtttcagtctgcagcgaatgttcagctatctgtgg
cgcgagacgctggaattgcagcgggacccggtacgcgccacgctggcgctgggcggttcg
ctgctgctgatgttcgtgatcggcttcggcatcaccatggacgtcgaggacctgagctat
gcggtactcgatcgcgaccagaccacgctcagccagagctacacgctgaacctggccggc
tcgcgctacttcaccgagcacgcgccgatcatagactacgacgatctcgaccggcggatg
cgtagcggcgaactgtcgctggccattgagatcccccctggcttcagccgcgacgtgttg
cggggccagaacgtgcagatcggcgcctggctcgacggcgccatgccgcaacgcgcggaa
accgtgcagggctacgttcaaggcatgcaccagcactggctactcgtacaggccagcgag
cgtggcggcgccagcgcagccggcaatgccagcgtcgagacgcgctttcgctacaacccc
gatgtcaagagcctgccggccatggtgccggcggtgattccgctgttgctgctcatgctg
cctgcgatgctgaccgcgctcgcggtggtgcgcgagaaggagacgggctcgatcaccaat
ctctacgtgacgccggtcacgcgcatcgagttcctgcttggcaagcaactgccctatgtc
ggtctggccatggtgaacttcctgctgatgagcctgctcgcggtcaccgtcttcggtgtg
ccggtcacgggcagcttcttcaccctgtcgctggccgcgctgatcttctccttcgccgcg
acaggcatggggctgctggcctcggccgtcacgcgcagccagatcgccgccatgttcttt
gccatgatcggcaccatcattccggccacccagttcgccggcctgatcgatcccgtgtcc
tcgcttgaaggctccagcaagttcatcggcgagatctaccccgccacgcacatgatctcc
atcagccgtggcgtgttcagcaaagcgctcggcctggccgatctggcggggccgttgtgg
tcgatgctgctgtcggttccggtgattctcggtgcggccgttttgctactcaagaagcag
gagcgctga

DBGET integrated database retrieval system