KEGG   Tolumonas auensis: Tola_2467
Entry
Tola_2467         CDS       T00904                                 

Definition
(GenBank) ABC-2 type transporter
  KO
K01992  ABC-2 type transport system permease protein
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2467
Transporters [BR:tau02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Tola_2467
SSDB
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_5
Other DBs
NCBI-ProteinID: ACQ94061
UniProt: C4LA86
Position
2694808..2695938
AA seq 376 aa
MSGRNVANIYDLGVKELWSLWRDPMMLVLIVYVFTASVYTSATSMPETLHNAPIAIVDED
NSALSQRIASAFYPPQFTPPAMIDYGDVDPGMDAGLYTFALVIPPNFQRDVLAGRSPAAQ
LNVDATRMSQAFTGSGYIQQIFTGEVNEFVKRYRGTDAPPVDLALRARFNPALDKAWFGS
VVQIINHITLLSIILTGAALIREREHGTIEHLLVMPVTPAQIMLSKVWSMALVVLIASFL
SLNLMVRGVLGVPVEGSIALFFAGAALSLFATTSMGIFIATLARNMPQFGMLMMLTIMPL
QMLSGGSTPRESMPEIVQNIMLIAPTTHFVELSQAILYRGAGLETVWQPFLALALIGTVL
FFLSLARFRKTIGQMA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgagcggaagaaacgttgccaacatctacgacctcggtgtcaaggagctgtggagcctt
tggcgtgatccgatgatgctcgtactcatcgtctatgtgttcaccgcgtcggtctacacc
tcggccacgtccatgccggagacgctgcacaacgcgcccatcgccatcgtcgacgaggat
aattcggcgctgtcccagcggattgcctcggccttctacccgccgcagttcacgccaccg
gccatgatcgactatggggacgtggacccgggcatggatgcggggctgtacaccttcgcc
ctggtcattccgcccaacttccagcgtgacgtgctggcggggcgatcgcccgccgcgcag
ctcaatgtcgacgccacccgcatgagccaggccttcaccggcagtggctatatccagcag
atcttcaccggtgaagtcaatgagttcgtcaagcgttaccgcggcaccgacgcgccaccc
gtggatctggcattgcgcgcccgcttcaaccccgcgctcgacaaggcctggttcggctcg
gtggtgcagatcatcaaccacatcacgctgttgtccatcatcctgaccggcgcggcgctg
atccgggagcgcgagcacggcaccatcgagcacctgctggtgatgccggtcacgcccgcg
cagatcatgctctccaaggtctggtcgatggccctggtcgtgctgatcgcctccttcctg
tccctcaatctcatggtgcgcggcgtcctgggcgttcccgtcgagggttccattgcgctg
ttcttcgctggcgcggcgctcagtctgttcgccaccacctcgatgggcatcttcatcgcc
accctggcgcgcaacatgccccaattcggcatgttgatgatgctcaccatcatgccgctg
cagatgctttcgggtgggtctaccccgcgcgagagcatgcccgagatcgtgcagaacatc
atgctgatcgcacccaccacccatttcgtggagctgagccaggccatcctctaccggggc
gctggcctggagacggtatggcagcccttcctggcgctggccctgatcggcacggtgctg
tttttcctgtcgttagcacgctttcgcaaaacgatcggccagatggcctga

DBGET integrated database retrieval system