KEGG   Tolumonas auensis: Tola_2468
Entry
Tola_2468         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Phasin_2
Other DBs
NCBI-ProteinID: ACQ94062
UniProt: C4LA87
Position
2695986..2696447
AA seq 153 aa
MSNETIPLNLFKANLELQLRLQRLVQENGQQWLENATRAGKDGIAESGAEIESLLKAQNW
QELATLPAQAFWRQFQHHVGGAQALTQVAIKNQTSFTQGLQKAIQDWQKSVTQAVGQGDA
VLPFQDMFKQWGAVWASAQDKEAPGKTGGRDAG
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagcaatgaaaccatccctctcaacctgttcaaggcgaacctggaactgcagttgcgc
ctccagcgcctggtgcaggaaaacggccagcaatggttggagaacgccacgcgcgcgggc
aaagacggcattgccgagtccggcgcggaaatcgaaagcctgctcaaggcccagaactgg
caggaactggccacgctgcccgcacaagcgttctggcgccagtttcagcaccacgtgggc
ggcgcgcaggcgctgacacaagtcgcgatcaaaaaccagacaagcttcacccaaggcctg
caaaaagccattcaagactggcagaaatcggtcacgcaggccgtaggccagggcgatgcg
gtactcccgttccaggatatgttcaaacagtggggggccgtgtgggcctcggcccaggac
aaggaggcaccgggcaagaccggtggccgcgatgccggctga

DBGET integrated database retrieval system