KEGG   Tolumonas auensis: Tola_2469
Entry
Tola_2469         CDS       T00904                                 

Definition
(GenBank) acetoacetyl-CoA reductase
  KO
K00023  acetoacetyl-CoA reductase [EC:1.1.1.36]
Organism
tau  Tolumonas auensis
Pathway
tau00630  Glyoxylate and dicarboxylate metabolism
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tola_2469
   00650 Butanoate metabolism
    Tola_2469
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.36  acetoacetyl-CoA reductase
     Tola_2469
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 GDP_Man_Dehyd Glyco_transf_5 YjeF_N DFP F420_oxidored RmlD_sub_bind
Other DBs
NCBI-ProteinID: ACQ94063
UniProt: C4LA88
Position
2696437..2697183
AA seq 248 aa
MPAEQRTALVTGGNGGLGAAIARALHDAGHTVLVIHSPGNSSIGAWLEAQAGEGYSFIAY
GADVADHASCQELAGLIQADGHHIDILVNNAGITRDATFRKLSYADWDAVLRVNLDSVFN
VTRPFIDGMLEKGWGRIVNISSINGSKGQFGQTNYSAAKAGMHGFTKALAQEVARKGVTV
NTVSPGYLDTKMVTSMSEEVVKQVIAGIPVGRLGRPEEIAALVAFIASESAGFMTGSNVS
MNGGQHMY
NT seq 747 nt   +upstreamnt  +downstreamnt
atgccggctgaacaacgcaccgccctggtcacgggcggcaacggtggcctgggcgcggcc
atcgcccgagccttgcacgatgctgggcataccgtgctcgtcatccactcgccaggcaat
tccagcatcggcgcgtggttggaagcccaggcgggcgaaggttacagcttcatcgcctac
ggcgcggatgtggccgaccatgcctcctgccaggagctggccggcctcattcaagcagac
ggtcaccacatcgacattctggtcaacaacgcgggcatcacgcgtgatgctacgttccgc
aagctgagctacgccgattgggatgcggtcctgcgcgtcaatctcgactccgttttcaac
gtcacccggccattcatcgacggcatgctcgaaaagggctggggcaggatcgtcaacatc
tcctccatcaacggctccaaggggcagttcggccagaccaattactccgccgcaaaagcc
ggcatgcatggcttcaccaaagcccttgcgcaggaggtggcgcgcaagggtgtgacggtc
aacaccgtctcgccggggtatctggatacgaagatggtgacgagcatgtcggaggaagtg
gtcaagcaggtgattgccggtattcccgtgggtcgtctgggacggcctgaggaaatcgcc
gcactggttgcattcatcgccagcgagtctgcggggttcatgaccggcagcaacgtgtcg
atgaatggtggccagcacatgtactga

DBGET integrated database retrieval system