KEGG   Tolumonas auensis: Tola_2470
Entry
Tola_2470         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF3141 FliT CmlA_N TerB
Other DBs
NCBI-ProteinID: ACQ94064
UniProt: C4LA89
Position
2697269..2699773
AA seq 834 aa
MNRDTTTSPTADWGQLLWDPLRLSAMASEYAVDAWQRSILYADVRRQRGNQYQEHLQEQT
PNVLDFASEVIMSGLDLPQPVNYGLVRILPPADTPSDPHKRPFVVVDPRAGHGPGIGGFK
PDSEVGAALKAGHPCYFVGFLPDPVPGQTVEDVMRAEAAFVRKVGELHPDSRGKPAVIGN
CQAGWQILMAAAVWPELFGPIIVAGAPLSYWAGDMPMRYAGGLTGGSWLTALTSDLGAGR
FDGAWLVQNFENLDPANTLWSKQYNLYAKVDTEGPRHLQFEKYWGGHVFLNDVEMQYIVD
NLFIGNKLSTAQLVTSDGVRIDLRNIRSPIVVFCSYGDNITPPPQALGWITDLYRNDLDV
MGHDQTIVYATHDSIGHLGIFVSGSVGRKEHQEFAANIDAIDVLPAGIHRMLVDENPDGS
QEGEPTGNAYLTRIQRSNIDEVREIVRPDPENDRRFAAVARISEVNLACYRSFVQPWMRA
LVTDQGAKWLEPLHPLRMGYELWSDRHPLAAAVHEAAQHVRDHRQPVSEANPFLQLQAQF
STAVEQMLDQFRDCRDQIYAQAFDTLYSLPLVQAMTGQSLHDDAPPRPHPSETPEHRQYL
AQELTRLEADIHSGGLAEAVIRALFFVLAARGEADGRHFRHAEQLVRPRLGSDFDMQVFR
HLVRRQALLMRLDEDATVSAIPGLLNGIAPDDIRQVAGMIVQVIGSGGVLSAQEQTRLEQ
VSTLFEQAERQAQAASAPAVISPATDTSATVVDAKSTTAMPRSASGTSAAVEDANAAPAM
PSSASDTSAPAINTTSKTSSPKPKAPQKKTATQKTVSKTPAAPRTSQTRRGKGK
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgaatcgagacaccacgacatcaccaacggccgattgggggcagttgctgtgggacccg
ttgcgactatcggcgatggcaagcgagtatgcagtggatgcctggcagcggtccattctg
tatgccgacgttcgccgccaacgcggcaaccagtaccaggagcatttgcaggagcagacg
ccgaacgtactcgacttcgcctctgaggtcatcatgtccgggctggaccttccgcagccg
gtcaactatggcctcgtacgtatcctgccgccagccgacacgccgagcgatccccacaag
cgaccgttcgtggtggtcgatccacgcgcgggccacggcccaggcatcggcggcttcaaa
cccgatagcgaggtcggcgcggccctcaaggctggccatccctgctacttcgtaggcttt
ctgcccgatcccgttcccggccagaccgtcgaagacgtcatgcgcgccgaagcggccttc
gtgcgcaaggtcggcgagctgcaccccgacagccgcggcaagcctgcggtcatcggcaat
tgccaggcaggctggcagatcctgatggcagccgccgtctggcccgaactgttcggaccg
atcatcgtggccggtgcgccgctgtcgtactgggcgggcgacatgccgatgcgctacgcg
ggcggtctgaccggcggtagctggttgacggcattgaccagcgatctgggcgccggccgc
ttcgacggcgcctggctggtacagaacttcgagaacctggacccggccaatacgctgtgg
agcaaacagtacaacttgtacgccaaggtcgacacggagggcccccgccacctgcagttc
gagaagtattggggcggccacgtcttcctgaatgacgtggaaatgcagtacatcgtcgat
aacctgttcatcggcaacaaactgagtacggcgcagctggtgacgtctgatggcgtgcgc
atcgacctgcgcaatattcgctcgccgatcgtggtgttctgctcctatggggacaacatc
acgccaccgccccaggccctgggctggatcaccgatctgtaccgcaacgatctggacgtg
atggggcatgaccagaccatcgtctacgccacccatgacagcatcgggcatctgggtatc
ttcgtctccggcagcgtcgggcgtaaagagcaccaagagttcgccgccaacatcgacgcc
atcgacgtgctgccggccggtatccaccgcatgctggtcgatgaaaatccagacgggtcg
caggaaggcgagccgaccgggaacgcctacctgactcggatccagcgcagcaacatcgat
gaagtccgtgagatcgtccgtcccgaccctgagaacgatcgccggttcgccgccgttgcg
cggatctccgaggtcaacctggcttgctaccgcagcttcgtgcagccatggatgcgtgcc
ctggtcacggaccagggtgcgaagtggctggagccgctgcatccgctgcgcatgggctat
gaattgtggtctgacaggcatccgctcgccgccgcagtacatgaggctgcgcaacacgtg
cgcgaccatcgtcagcccgtctccgaggccaaccctttcctgcaactgcaggcgcagttt
tccaccgccgtcgaacagatgctggatcaattccgtgattgccgcgaccagatctacgca
caggcgtttgacacgctgtacagcctgccgctggtgcaggccatgactggacagagcctg
cacgacgatgcaccgccgcgaccccatcccagcgagacgcccgagcatcgccagtatctg
gcgcaagagttgacacggctcgaagcggatattcacagcggcgggctcgccgaagccgtc
atacgggcactgttcttcgtgcttgcggcgcgtggcgaggccgacgggcggcacttccgg
cacgcagagcaactggtgcgtccccgcctgggcagcgacttcgacatgcaggtctttcgc
cacctcgttcgtcggcaggctttgctcatgaggctcgacgaggacgccacggtgtccgcc
atccccggattgctcaacggcatagcgcctgatgacatccgccaggtggcgggaatgatc
gtgcaagtgattggcagcggcggtgtgctgtccgcacaagaacaaaccaggctggaacag
gtttctaccttgttcgagcaggccgagcgccaagcgcaggcggcttcggcgcccgccgtg
ataagtcccgccactgatacctccgctacggtcgtggacgcgaagtcgacaaccgccatg
ccacgctctgccagtggcacatccgctgcggtcgaggatgcgaatgcggcgccagccatg
ccgagctccgccagtgacacctccgctccggccataaacacgacctccaagacatcctct
ccaaagcctaaggcgcctcagaagaaaactgctacgcagaaaactgtgtccaagacgcca
gccgccccgcggacaagtcaaacacggcgagggaaaggcaaatga

DBGET integrated database retrieval system