KEGG   Tolumonas auensis: Tola_2471
Entry
Tola_2471         CDS       T00904                                 

Definition
(GenBank) Phosphate acetyltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
tau  Tolumonas auensis
Pathway
tau00430  Taurine and hypotaurine metabolism
tau00620  Pyruvate metabolism
tau00640  Propanoate metabolism
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Module
tau_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tola_2471
   00640 Propanoate metabolism
    Tola_2471
  09102 Energy metabolism
   00680 Methane metabolism
    Tola_2471
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Tola_2471
Enzymes [BR:tau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Tola_2471
SSDB
Motif
Pfam: PTA_PTB MaoC_dehydratas GYD
Other DBs
NCBI-ProteinID: ACQ94065
UniProt: C4LA90
Position
2699770..2701191
AA seq 473 aa
MTTSSAPVDGAADALQVLRNRTFDEIAIGDSASLERAFSPQDIHMFALQSGDVDPESSVS
SPSRDTTEAICANVLISAVLGTRLPGPGTQYVSQNLRLLGAVRPGDRLTVQMQVSSKDTA
THHVTLDCTCTSQEGVAVFQGQVEVVAPTERIERTRTALPEIHPDAQGRTGLQHLLAHVA
HLQPIRVAVAHPCDVPSLSAALEARHAGLIEPVLVGPRGRLEAVATEAGLDLADVAIVDV
PHSHAAAQQAVALAAAGEVEALMKGSLHTDELMSALVSAAAGLRTKRRVSHCFLLQTPAY
PRPFIVTDAAINIAPTLEQKADIIRNAIELAQVIGVREPKVAILAAVETVSPTMTATLDA
AALCKMADRGQITGGLLDGPLAFDNAISIAAARTKGIVSEVAGQADILVVPDLESGNMLA
KQLIFLGGAASAGIVLGAKVPVILTSRADSRDTRIASCAIALMLAHHYRLSPP
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgacgacgtcctccgcaccggtcgatggcgccgccgacgcattgcaggttctgcgcaac
cgcaccttcgacgagatcgccatcggcgacagcgccagcctcgaacgcgcgttttcgccg
caagacatccacatgttcgcgctgcaatcgggcgatgtggatccggaatcttcggtgtct
tcgccctcgcgggacaccacggaggccatttgtgcaaacgtcctgatctcggctgtgctg
ggaacacgcctgccggggcctggaacccaatatgtcagccagaacctgcgcttgctcgga
gccgttcggcccggcgacaggctgaccgtgcagatgcaggtgagcagcaaagacacggcc
acccatcacgtcacgctggactgcacctgcaccagccaggagggggtggcggttttccag
ggccaggtagaggtcgtagcgcccactgagcgcattgaaagaacgcgcacggcgttgccg
gaaatccatccggatgcgcagggccgcacaggcctgcagcacctgctggcgcatgtcgcg
cacttgcaaccgattcgggtagccgtcgcccacccctgcgatgtccccagcctgtccgct
gcgctcgaagcgcgccacgcggggttgatcgagccggtgctggtcgggccacgagggcgg
ctcgaagcagtcgccaccgaggccgggctggatctggccgacgtcgccattgtggacgtc
ccgcacagccacgccgctgcgcagcaagccgtcgccttggcagccgcaggtgaagtcgaa
gccctgatgaaagggagcctgcacaccgacgaactgatgtccgcgctggtttcggcagca
gcggggttgcgcaccaagcgccgggtcagccattgcttcctgttgcagacaccggcctat
ccgcgcccgttcatcgtcaccgatgcagcgatcaatatcgccccgactctggaacagaag
gcagacatcatccgcaacgccatcgagctggcgcaggtgatcggcgtgcgcgaacccaag
gtcgcaatcctggccgcagtcgagacggtcagcccgacgatgacggccacgctcgacgcg
gcggcgctgtgcaagatggccgatcgcggccagatcactggcggcctgctcgacgggccg
ttggccttcgacaacgcgatctccatcgccgctgcgcgcaccaaggggatcgtctccgag
gtcgccgggcaggccgacatccttgtcgtgcctgacctggagagcggcaacatgcttgcc
aagcagttgatattcctgggcggcgcagccagcgccggaatcgtcctcggagcgaaagtg
ccggtcattctgaccagccgcgccgactcgcgcgatacacgcatcgcctcatgcgcgatt
gcactgatgctggcgcaccactatcggctgtcacccccgtga

DBGET integrated database retrieval system