KEGG   Tolumonas auensis: Tola_2472
Entry
Tola_2472         CDS       T00904                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Epimerase Methyltransf_25 RmlD_sub_bind T4SS-DNA_transf 2-Hacid_dh_C HHH_5
Other DBs
NCBI-ProteinID: ACQ94066
UniProt: C4LA91
Position
2701235..2701987
AA seq 250 aa
MKYSFSGRVALVTGAGSGIGEAIARLLASNGLSVVVSDVSADNAQRVAKLISADGGQAVA
NVADVARINDVEAAVACAVDMFGGLHFAVNNAGISGDQSPVGELDPAAWSRVIDINLNGV
FYGLRHQIPAILRSGGGAIVNVSSILGVVGDAGNPAYVAAKHAVTGLTRSAALAYAAKGV
RINSIHPGYVRTPILDFLDESALQEAVGLHPIGRLGTPDEIAHAVTFLLSEGSSFFAGTQ
LIADGGYTAR
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaagtactcattttctggccgcgtagccctggtcaccggtgcaggatccggcattggc
gaggccatcgcgcgacttcttgcgagcaacggcttgagtgtcgtcgtctcggatgtcagc
gccgacaatgcgcagcgcgtcgccaagctcatcagcgccgatggcggccaagccgtggcc
aatgtggccgacgtggcacgcatcaatgacgttgaggctgctgtggcctgcgcagtcgat
atgttcggcggccttcattttgcggtcaacaacgccggtatcagtggcgaccagagccca
gtgggggaactggatcctgccgcctggagccgggtaatcgatatcaacctgaacggagtg
ttctatggcctgcgccatcagattcccgccatcctgcgttcgggtggcggcgccatcgtc
aacgtctcttcgatcctgggggtggtcggcgatgcaggaaacccagcgtacgtcgcagcc
aagcacgctgttaccgggctgacccgctcggcagcgctggcctatgcggccaagggagtc
cggatcaactcgatccatcccggttacgtgcggacgcccatcctggatttcctcgacgaa
tcggcccttcaggaggctgttggcctgcatccgatcggccgtctgggcaccccggacgaa
atcgcccatgccgtgacgtttttgctatcggaaggaagcagcttctttgcgggcacccag
ctcatcgccgacggcggctatacggcacgctga

DBGET integrated database retrieval system