KEGG   Tolumonas auensis: Tola_2473
Entry
Tola_2473         CDS       T00904                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
tau  Tolumonas auensis
Pathway
tau00430  Taurine and hypotaurine metabolism
tau00620  Pyruvate metabolism
tau00640  Propanoate metabolism
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Module
tau_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tola_2473
   00640 Propanoate metabolism
    Tola_2473
  09102 Energy metabolism
   00680 Methane metabolism
    Tola_2473
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Tola_2473
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Tola_2473
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: ACQ94067
UniProt: C4LA92
Position
2702064..2703305
AA seq 413 aa
MMDATTARSGRPGHGLILVLNCGSSSIKFAVFDPSATPLPRQALWNGKVLGIGGADPDFE
ETGVAPFPIKLDTAHPYRAALRIIRDRVSQRLDGRRIGAVAHRIVHGGSRYFEPVRVDAQ
VLTDLQGYIPLAPLHQPFALEAIDILLREQPELPQVACFDTGFHHTIPKLEQLLPLPYAA
WERGLRRYGFHGLSYEYMAEALPERHGDAARRRTIVAHLGSGASLCAMQGLKSVATTMGF
SALDGLMMGTRTGALDPGAVLYLMEIEKLSLEQVGRVLYHESGLLGVSGISAEPRVIVRH
ENDEGETGERARLALDLYVRRIVREIGALVAVLGGLDMLVFTAGVGEHNAFIRERIGAAL
GFLNIALDTDANASHAATISSDHSQVIVTIEPTNEEWIAASHALSCLDREKVR
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatggatgcgaccacggcccgctccggacgccccgggcacggactgatccttgtactg
aactgcggttcatccagcatcaagtttgcggtattcgacccttcggccacgccactgcct
cgccaggcgttgtggaatggcaaagtgctgggaatcggcggcgccgatccggatttcgaa
gagaccggggttgcgccgttcccgatcaaactggacacggcacatccctatcgtgccgcg
ctgcgcatcatccgcgatcgcgtcagtcagcggctcgacggccgccggataggtgcggtc
gctcatcggatcgtccacggtggcagcaggtatttcgagccagtgcgggtggacgcccag
gtgctcaccgatctgcagggatacatcccgctggcgccactgcaccagccgttcgcgctg
gaggccatcgatatcctgctgcgcgaacagccggagctgcctcaggtggcctgcttcgac
accggcttccatcacaccatccccaagctcgagcagctcctgccgttgccctacgccgca
tgggagcgcggtctgcgccggtacggatttcacggcctgtcgtatgagtacatggctgag
gctttgcccgaacgccatggcgacgcggcgcgcaggcgcaccatcgttgcccacctgggc
agtggcgccagcctgtgtgccatgcaaggactcaaaagcgtggccaccaccatgggtttc
tccgcgcttgacgggctgatgatgggcacccgcaccggtgcgctcgatccaggcgccgtg
ctctacctgatggagatcgagaagctttcactggaacaagtggggcgtgtcctctatcac
gagtccggtctgctcggcgtttcgggaatctcggccgagccgcgcgtcattgtccggcac
gagaacgatgaaggtgaaacgggtgagcgagcgcgcttggcgctggacctctacgtgcgt
cgcatcgtgcgcgagatcggtgccttggttgctgttctgggcggtctggacatgctggta
ttcacggcaggtgtcggtgaacacaatgcgttcattcgcgagcgcatcggtgcggcactg
ggttttctgaacattgccctggataccgacgccaatgccagccacgcggcgacgatttcc
agcgaccacagccaggtcatcgtgacgatcgaacccaccaatgaagagtggatcgccgcc
agccatgcgctgtcctgcctggacagggagaaggtgcgatga

DBGET integrated database retrieval system