KEGG   Tolumonas auensis: Tola_2474
Entry
Tola_2474         CDS       T00904                                 

Definition
(GenBank) sodium/glutamate symporter
  KO
K03312  glutamate:Na+ symporter, ESS family
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2474
Transporters [BR:tau02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Tola_2474
SSDB
Motif
Pfam: Glt_symporter
Other DBs
NCBI-ProteinID: ACQ94068
UniProt: C4LA93
Position
2703302..2704507
AA seq 401 aa
MKIDAFHGFTLAILLLFVGKGLVARSGILRRYSIPESLVGGLACALVVFVLYYGMGVTVS
FDLEARDALLLYFFAAIGLSTDARTLRHGGRPLLILSGLAIGFMVLQNLVGMETARAFGL
DPRAGLMVGSISLTGGVGTTLAWSDYFVQNLGIAQAQELGLAANMIGLIAACTIGGPIAG
LLMRRHRLRASGDSALEIGTLHSDEQHARLDYYGVLLALLWLNLALMLGSGINALVALTP
VTLPAFVGCLLAGILLRMVADWMRPSGRGRLWNWPSMQPGIALVSDMSLGLFLTMALMGL
RLWELQPVLAFITVAMLVQIILVIAFVFLIVFRAMGKDYQAAVMCAGFGGIALGSTATAI
ANMTAVTREHGAAREAFIVVPLVCGFVIDIANALVISLMAG
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaagatcgatgccttccatggattcacgctcgccattctgctgttgtttgtgggcaag
ggcttggtagcgcgttcgggcatcttgcgtcgatacagcatcccggaatccttggtgggc
ggcttggcttgcgccttggttgtcttcgtcctgtactacgggatgggggtcacggtcagt
ttcgatctggaagcgcgcgatgcgctgctgctgtacttctttgccgccattggactgagt
accgacgcccgcacactgcgccatggtggacggcctttgctgatcctgtcggggttggcc
atcgggttcatggtgctgcagaacctcgtcgggatggagacggcccgcgcattcggcctg
gatccgcgcgccggtctcatggtcggttcgatttccctgaccggaggggtgggcaccacc
ttggcctggtccgattacttcgttcaaaacctcggcattgcgcaagcgcaggaactgggg
ttggcggcgaacatgatcggcctgatcgcggcctgcaccatcggcggcccgatcgcaggt
ctgctcatgcgcaggcatcgacttcgagcctccggagacagcgccctggaaattggcacg
ctgcacagcgatgagcagcatgcccgcctggactactacggcgtgctgctggcattgctc
tggctcaacttagccttgatgttgggctcaggaatcaatgccttggtcgcgcttacccct
gtcacgctgcccgcctttgtgggctgcctgctggccggaattctcctgcgcatggtggcc
gactggatgaggccgagtgggcgcgggcgtttatggaactggccaagcatgcagccaggc
atcgccctggtctccgacatgtcattgggcctgtttctgaccatggcgctgatggggctc
aggctctgggaactgcagcctgtgcttgccttcatcacggtggcgatgctggtgcagatc
atcttggtcatcgcgttcgtttttctgatcgtttttcgggcaatgggcaaggattaccag
gctgcagtgatgtgtgccggtttcggcggaatcgcgctgggctctaccgccaccgccatc
gccaacatgacggcggtcactcgggagcatggcgctgcgcgcgaggcgttcattgtggtg
cccctggtgtgcgggttcgtcatcgacattgcgaacgcactggtgatcagcctgatggcc
ggttaa

DBGET integrated database retrieval system