KEGG   Tolumonas auensis: Tola_2476
Entry
Tola_2476         CDS       T00904                                 

Definition
(GenBank) UspA domain protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Usp DUF3197
Other DBs
NCBI-ProteinID: ACQ94070
UniProt: C4LA95
Position
2706526..2707020
AA seq 164 aa
MYSRLLVPLDGSSTANLALHHAAVLARLSGATIILLHIIEEMKHSNGFERPRIYLEEVRP
GFLAAGQKLLDEAALWLRQEGLTVETVLLESKGERVSVLIAQQALATGCELVVLGTHGRR
GVDRLLLGSDAEQLARIAPVPVMLVRQPHSVIATATPGQGGTPA
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtactcaagactgctggttccgctcgacggaagttctaccgccaatttggccctccac
cacgccgcggtgctggcacgcctaagcggtgcaaccatcatcttgctgcacattatcgag
gaaatgaagcacagcaacggcttcgagaggccgagaatttaccttgaagaagtaaggcca
ggcttcctggcggccgggcagaagctgctggacgaggcggcgctctggctgagacaggaa
ggcttgacggtagagaccgtccttctggagagcaagggcgagcgcgtctcggtacttatc
gcgcagcaggcactggctaccggatgcgagctggtggtgctgggcacccacggacgtcgg
ggcgtggacaggctgctgctgggaagcgatgccgagcagctcgctcggatcgcaccggtt
cccgtgatgctggtacgccagccccattctgtcattgctactgcaacccctgggcagggt
ggcacgccagcgtga

DBGET integrated database retrieval system