KEGG   Tolumonas auensis: Tola_2477
Entry
Tola_2477         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF2219 KASH
Other DBs
NCBI-ProteinID: ACQ94071
UniProt: C4LA96
Position
2707017..2708090
AA seq 357 aa
MTKVQSTDQTEWRLKVAAPLLLLLLSASAQAQSCHQDNPLRSTGTLNLRIDNDMFGGMGQ
DQGYSNGFLASWVSPNLVDYSDDPCLPRLVRGLNRFLTMLQPQGFDEQNMTIGFGQMMYT
PNDKTRSDLIKDDRPFAGALMLSLGYNARRGDTLRTSQLRVGVVGPSSQARQVQNWWHDT
VGVDRFNGWRHQLRDEPVLQLLHERRTRVIRQENVSGWGWDLTRHWGGSLGNFATYANVG
GELRYGLRLPDDLGTAPLRPAGENTSPVRKTAGSNWNGHLFVALDGRWVLHDITLDGNTF
KSSHSVDKRPFVADVGYGIAMTQGNWRIAIARYHRTREFRGQKEIPVYGTITVGRRF
NT seq 1074 nt   +upstreamnt  +downstreamnt
gtgacgaaggttcagtccaccgaccaaactgaatggaggctgaaagtcgcagcccccttg
ctgctgctgttgctgagcgcctccgcacaggcccagtcctgccaccaggacaacccgctg
cgctcaacgggaacgctcaatctgcggatcgacaacgacatgttcggcggcatgggacag
gatcaagggtactccaacgggtttctcgccagttgggtttcccccaacctcgtggactat
agcgatgacccttgtctaccgcgtctcgtccgtgggctgaatcgctttctcacgatgctc
caaccccaaggcttcgacgaacagaacatgaccatcggcttcgggcagatgatgtacacc
ccgaacgacaaaacgcgcagcgatctcatcaaggatgatcgtcctttcgcgggcgccttg
atgttgagccttggctataacgcgaggcggggcgatacgctgcgcacttcgcaactccgc
gtgggggtggtggggccctcctcccaggccaggcaagtccagaactggtggcatgacacc
gtcggagtggacagattcaatggctggagacatcaactgcgcgacgaacccgtgctgcag
ttgctccacgaacgccgaacacgagtcatcaggcaagaaaacgtcagcggttggggttgg
gatctgacccgccactggggcggcagcttgggcaatttcgccacctacgcgaatgtcggc
ggagaactgcgctatggcctacgcctgccggacgacttaggcaccgcaccgctgcgcccg
gctggagaaaacacctcgcccgtgcgtaagaccgctggcagcaactggaacgggcacctg
ttcgtggcactcgacggtcgctgggttttgcacgacatcacgttggacggcaatacgttc
aagtccagtcatagtgttgataaacggccattcgtggccgatgtgggctatggcatcgcg
atgactcagggcaactggcgcatcgcgatagcccgctaccaccgcacccgcgaatttcgt
ggacaaaaggaaatcccggtctacggaacgatcaccgtaggacggcgattctga

DBGET integrated database retrieval system