KEGG   Tolumonas auensis: Tola_2478
Entry
Tola_2478         CDS       T00904                                 

Definition
(GenBank) hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Other DBs
NCBI-ProteinID: ACQ94072
UniProt: C4LA97
Position
2708090..2708221
AA seq 43 aa
MQIDSLNAMQATLLLFMTRAWLLVELPRRRSTANAVVISQLAR
NT seq 132 nt   +upstreamnt  +downstreamnt
atgcagatcgattccttgaacgccatgcaagccactctgttgctgttcatgacaagagcc
tggttgcttgtggagctaccacgtcgacgcagtactgccaatgccgtcgtcattagccag
ttggcaaggtga

DBGET integrated database retrieval system