KEGG   Tolumonas auensis: Tola_2479
Entry
Tola_2479         CDS       T00904                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
tau  Tolumonas auensis
Pathway
tau00030  Pentose phosphate pathway
tau00230  Purine metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau01230  Biosynthesis of amino acids
Module
tau_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tola_2479
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tola_2479
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     Tola_2479
SSDB
Motif
Pfam: Pribosyltran_N Pribosyltran Pribosyl_synth PRTase_2
Other DBs
NCBI-ProteinID: ACQ94073
UniProt: C4LA98
Position
2708294..2709190
AA seq 298 aa
MQRLTLALPGNEDLARGIAQACGSEAGRIETRRFPDGESYVRLHGEPADRIVDVICTLAH
PDPQFLLLAFAADAARELGAQEVNLIAPYLAYMRQDKRFHDGESVTSRSFARLVSSTFDK
LLTVDPHLHRYPTLSAVYTIPTITLHAAPLLADWIANHVEEPLIVGPDEESEQWAGAIAS
RIGVPHAVLRKTRHGDRSVDIDVPDLSIWRGRTPVLVDDIASSGRTLAVAARKLAEQGMR
KPECVVVHALFAEDAWAQLTPLFARITSTDAVPHPSNRIGLASLIADALSSGKTDPRG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcaacgactcaccctggccctacccggcaatgaagatctggcccgcggcatcgcgcag
gcatgcggcagcgaagccggccgcatcgaaacgcgccgattccccgatggcgagagctat
gtccggttgcatggcgaacctgccgatcggatcgtggatgtgatttgcacgctggcccat
cctgatccgcagttcctgcttctggcttttgccgctgacgcggcgcgcgaacttggcgcg
caagaggtgaacctgatcgcaccgtatctggcctacatgcgccaggacaagcgattccat
gacggagaaagcgtgacgtcgcggtccttcgcacgtctggtctcatcgaccttcgacaag
ctgctcacggtggatccgcatctgcaccgctatccgacactatcagcggtctacacgatc
cccaccatcaccttgcatgccgcaccactgctggccgactggatcgcgaatcatgtcgaa
gaacctttgatcgtgggccccgacgaggaaagcgagcagtgggccggcgccatcgcgtcc
cgcatcggcgtaccgcacgctgtgcttcgcaagacacgccatggcgatcgcagcgtggac
atcgatgttcccgacctgtcgatctggcgcggcagaacgccggtgcttgtggacgacatc
gcatcatcaggccgcacgctcgccgtcgcggcgcgcaagctcgccgagcaaggaatgcgc
aagccggagtgcgtagtggtgcatgccctgttcgccgaggatgcctgggcccaattgaca
ccgttgtttgcccgaattacgtccaccgacgcagtaccgcatccgagcaaccggattggt
ctcgcttcgctgattgccgacgctctctctagcgggaaaaccgatccgcgaggctga

DBGET integrated database retrieval system