KEGG   Tolumonas auensis: Tola_2480
Entry
Tola_2480         CDS       T00904                                 

Definition
(GenBank) D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: XFP XFP_N
Other DBs
NCBI-ProteinID: ACQ94074
UniProt: C4LA99
Position
2709229..2711607
AA seq 792 aa
MSSQANLATDWRAGYGPIAHRSETIERMQALVQRLVAQRRIADEASAHALLAAADRVACT
AMSVVAHMTYARRIDRSGCPLGSDDFKQTPEGHTGGSLNMVPAFVGYLLANALTGTTRGW
LMGQGHCVAAIEAVNALTGDVSAAQRGRYDRSEAGLSRLIGDFYSYAIDKQGRPAVPLGS
HAGPNTAGAISEGGYLGFAGLQYVHTPLPGESLVAFLSDGAFEEQRGSDWAPRWWRAEDC
GFAIPVMILNGRRIEQRTQIVQEGGATWLAEDLRHNGFDPVIVDGRDPMAIAWAIVEAED
TLSAFAARSDRRYPVKLPYVIAETEKGFGFPGAATNAAHNLPLNGNPREDAQAREAFNAG
AAALFVPESELENALTVLANHGQSQRSRESEHPMALRHPASPHLPMPAWAPTEVSGSAMS
ALDRWFVELVQANPQLRIRIGNPDELASNKMGTTLALLKHRVNVPEPGVPESTDGSVVTA
LNEEAVAAAALANKGGLNLIVSYEAFAVKMLGLMRQEIIFARRQKELGQPPGWISVPLIV
TSHTWENSKNEQSHQDPTIGEALLGEMSDTARVLFPVDANTASAALRAVYASRGQVACVV
VSKRDTPNHFNAAAAQSLVEHGAAHVAGDPATAQLQFVVIGAYQLEEAFKAHARLERHGL
ASCVTVVIEPGRLRIPRDDLEATFVVGDEALQALFPPHLPRVLISHTRPEPMLGVLRRID
SGTSKTRALGYINRGGTLDVAGMLIANRCTWVDAIYAAAQVTGRNSSQVAAAATDERISS
GSDAVRGDRAGS
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgtcctctcaagctaacctcgcaaccgattggcgtgctggttacgggcccatcgcgcac
aggtctgaaaccatcgaacgtatgcaggccctagtgcaacgtctggtcgcgcaaaggcgt
atagcagacgaagcctcggcccatgcgctgctggctgcagccgaccgggtggcctgcacg
gccatgagcgtagtggcgcatatgacctatgcccggcgcatcgaccgaagcggctgccca
ctgggctccgatgatttcaaacaaacgcccgaaggccacaccggcggctcgctcaacatg
gtgccagccttcgtgggttatctgttggccaacgcgctgaccgggacgacacgcggctgg
ctcatggggcaggggcactgcgtggccgcgatcgaggcggtgaacgcactgaccggcgat
gtatccgccgcccagcgtggacgctacgaccgcagcgaggcgggcctgtcgcgtttgatc
ggggacttctactcctatgccatcgataagcagggtcggcccgcggtaccgctgggtagc
catgccgggccgaacacggccggcgcgatctccgaaggcggctatctggggttcgccggg
ctgcagtatgtgcacacgccgttgccgggagaaagcctggtggcattcctcagtgatggc
gctttcgaggaacaacgtggctcggactgggcgccgcgctggtggcgcgccgaggactgc
ggcttcgccatcccggtcatgattctcaacggacggcgcatcgagcagcgcacccagatc
gtgcaggaaggtggcgctacctggctggccgaggacctgcgccacaacggcttcgatccg
gtcatcgttgatggacgtgatccgatggcgatcgcatgggccattgttgaagccgaagac
acgctgagcgccttcgccgcacgctcggatcggcgctatccggtcaagctgccctacgtg
atcgccgagacggagaaaggttttggcttcccgggcgcggcgaccaatgccgcccacaac
ctgccgctgaacggcaatccgcgcgaggatgcgcaggcacgcgaggccttcaacgcaggg
gctgcggcgctgttcgtgcccgagagcgaactggaaaacgcgctcaccgtccttgcgaat
cacggccagagccagcgctcgcgcgaaagcgagcaccccatggccctacgccatccagcg
agccctcatctgccgatgccggcctgggcgccaactgaggtatcgggcagcgccatgtcc
gcactggaccgttggttcgtggagctagtgcaggcaaatccacagttgcgcatccggatc
ggcaatcccgatgaactggccagcaacaagatggggaccacgctagcgctgctcaagcac
cgcgtcaacgtgcccgaacccggcgtcccggaatcgacggatggctcggtggtcaccgca
ctcaatgaagaagccgttgcggccgccgccctcgccaacaaaggggggctgaacctgatc
gtcagctacgaggcattcgcggtcaagatgcttggattgatgcgccaggagatcatcttc
gcgcgtcggcagaaggagctgggccagccgccaggctggatctccgtcccgctgatcgtc
acatcccacacctgggagaacagcaagaacgagcagtcacaccaggacccgaccattggc
gaagcattgctgggggagatgtcggacaccgcacgcgtgttgttcccggtggatgccaac
acggcgtccgccgcgctgcgagcggtctacgccagccggggccaagtggcctgtgtggtg
gtctccaagcgcgacacgccgaatcacttcaacgccgccgccgctcaatcgctggttgag
cacggagcagcccatgtagccggcgatccggctacagcacaactgcagttcgtggtgatt
ggcgcctaccagttggaggaagcgttcaaagcccacgcccgcctggagcgccatggactt
gcgtcgtgcgtcactgtagtgatcgaacccggccgcctgcgcattccgcgagatgacctt
gaggccaccttcgtggtcggtgacgaagccctgcaagcactcttcccgcctcacttgcct
cgcgtgttaataagccatacccgcccagagccgatgctgggtgtgctgcgccgcattgac
agcggcacctcgaagacgcgggctttgggctacatcaaccgcggcggcacgctcgatgtg
gctggaatgttgatcgccaaccgctgcacctgggtggacgccatctatgccgctgcgcaa
gtgaccggccggaacagttcgcaggttgctgcggccgcgaccgacgagcgaatttcaagt
ggttctgacgcggtccgcggcgaccgcgccggttcctga

DBGET integrated database retrieval system