KEGG   Tolumonas auensis: Tola_2481
Entry
Tola_2481         CDS       T00904                                 

Definition
(GenBank) beta-lactamase domain protein
  KO
K07576  metallo-beta-lactamase family protein
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    Tola_2481
SSDB
Motif
Pfam: Beta-Casp Lactamase_B RMMBL Lactamase_B_2 Lactamase_B_6 Lactamase_B_3
Other DBs
NCBI-ProteinID: ACQ94075
UniProt: C4LAA0
Position
2711643..2713001
AA seq 452 aa
MLSLTSLGGAGTVTGSKHLITHGNTRILIDCGLFQGLKNLRELNWQRLAVEPKDIDAVVL
THAHLDHCGYLPRLVLDGFRGKIFSTSATRDVAELILLDSAWLQEKDADFANRKGFSKHK
PALPLYRVRDAERTLLQFKPVPLHQETELPGNARLLLRSAGHILGAATAQIDIGGKRLVF
SGDLGRFDDMVMPDPEPVTAADYIIIESTYGNRRHDRSDAVEALGDIIERTTRRGGTVVI
PAFAVGRAQSLIYDLWLLRQRGRLRTVPVYLDSPMATSATALLHRHADDHKLAQHDFEAA
FSEVTYMRDVEESKALSANRYPKVIISASGMATGGRVLHHIEAFGGSHQNTLLFSGFQAA
GTRGRKLLEGAREVKIHGRWMPIKAEVAELAMLSAHADSDELMRWLGGFTRAPEGVFIVH
GESNASEALRERIQRELKWHASVPMQNQEFAL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctctcattgaccagcctgggcggtgccggcaccgtcaccggctccaaacaccttatc
acccatggcaatacccgcatcttgatcgactgcggactgttccagggattgaaaaacctg
cgcgaacttaactggcagcgcctggcagttgagcccaaggacatcgatgcggtcgtatta
acgcatgcgcacctggatcattgtgggtatctgccccgattggtgctggacgggttccgc
gggaagattttctcgacctcagccacgcgagatgtcgccgaactcatcctactcgacagc
gcctggttgcaggagaaggacgccgatttcgccaatcgaaaaggattttccaaacacaag
ccagcccttccgctgtatcgggttcgggatgcagaacgtacgctcctgcagttcaaaccg
gtgccgctgcatcaagagactgaattgccgggcaatgcccgtctactgctgcgcagcgcc
ggtcacattcttggggcggcgacggctcagatcgacattggcggcaagcgtttggtgttc
tccggcgacttgggacgctttgacgacatggtcatgcctgatcctgaaccagtcacggca
gcggactacatcatcatcgagtccacctatggcaatcgtcgtcatgaccgttccgatgcc
gtcgaagcgctgggcgacatcatcgagcgcacgactcgccgcggaggcaccgtagtgatt
cccgcttttgccgttggacgcgcgcagtcgttgatctatgacctatggctgttgcgacag
cgcggtcggctccgcaccgtgcccgtctatctggacagtcccatggccaccagcgcaact
gcgctgctgcaccgccatgccgacgaccacaagctcgcacaacacgatttcgaggcggca
ttctcagaagtcacatacatgcgcgacgttgaagagtccaaggcgctatcggcgaatcgc
taccccaaggtgattatttccgccagcggcatggccaccggtggccgcgtgctgcatcac
atagaagcgtttggcggcagtcatcagaacacgctgctgttctctggattccaggcagca
ggtacgcgcggacgcaagctgcttgagggcgctcgcgaagtcaaaattcatgggcgctgg
atgccgatcaaggcggaggtcgccgagcttgcgatgttgtcggctcatgccgacagcgat
gaactgatgcgttggctgggcggctttacccgggcgccggaaggggtgttcattgttcat
ggtgaatccaatgcctccgaggcgctgcgcgaacgtattcagcgcgaactcaaatggcac
gcatcggtgcccatgcaaaaccaggagttcgccctgtga

DBGET integrated database retrieval system