KEGG   Tolumonas auensis: Tola_2483
Entry
Tola_2483         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: LysR_substrate HTH_1 MLTR_LBD MarR_2
Other DBs
NCBI-ProteinID: ACQ94077
UniProt: C4LAA2
Position
2714702..2715592
AA seq 296 aa
MELRHLRCFIVLAEELHFTRAAERLHIEQSPLSRTIKELEDELGVVLFDRNRRGTALTPA
GAAFLQDIRRLFTVLEQAQENVRAVAAGLRGNLRIAVSDGATDPRLSAFLARCRAEEPEV
EIRLSEVPLAEQLRGLRSGDFTIGFAHTADVGDGIVAEPIWRDPLVLAVPARHELLAHRE
VPLHELGSHPLVLCDPQVCEGYCHQLAQLLQPLEHKPNVVEHASSLDMMLTLVGAGYGVG
FTTTTRIAGYQRPDVVIRPLAMESAVITTYLLWSENSSMSVSLERFIARLRDRLGD
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaactgcgacacctgcgttgctttatcgttttggccgaagagcttcatttcacacgg
gccgctgagcgcctgcatatagagcaatcccccttgtctcgaactatcaaagagcttgag
gacgagctaggggttgtgctcttcgatcggaatcgccggggcacagcgctgacccctgct
ggcgccgccttcttacaggacatccgcaggctgttcactgtcctggagcaggcacaggag
aacgttcgagcggtcgcagcaggcttgcgagggaacctgcgcattgccgtctccgatggt
gcgaccgaccctcggctctcggcgtttctggcccgttgccgcgccgaggagccggaggtc
gagatacgtctgtccgaagtgcctttggccgagcaattgcgcggcttacgatcaggcgac
ttcacgatcgggttcgcgcacaccgccgacgtcggtgatggcattgttgcggaaccgatc
tggcgagacccgctggtgcttgctgtgccagcccggcacgagttgctcgcccacagggag
gttccacttcatgaactcgggagccacccgctcgtcttgtgcgatccacaggtgtgcgag
gggtactgccaccaactggcacagctcctgcagcctctggagcacaagccgaatgtcgtt
gagcacgcgtcctcgctggacatgatgctcacccttgtcggtgcaggctacggcgtcggc
ttcacaacgacgaccaggatcgctggctaccagcgtccggatgttgtgatccgtcccttg
gcgatggaatccgcagtcatcactacctacttgctttggtccgaaaacagcagtatgtcg
gtttcgctggagcgattcatcgctcgcctacgcgaccgtttgggcgactga

DBGET integrated database retrieval system