KEGG   Tolumonas auensis: Tola_2485
Entry
Tola_2485         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: LysR_substrate
Other DBs
NCBI-ProteinID: ACQ94079
UniProt: C4LAA4
Position
2716014..2716655
AA seq 213 aa
MHDATNRLSHFKLAIAPGVPSSRLSKLLALQRAEEPEVTIAFFEVTADDLVAGLREGRYD
AGMSLQGLADPSLSSQPLWSESMAVALPLRLPLLDQATLTIAGLQDYMVFRWQAEACPLL
DQRLSSFLPEDQRNIRYMTSFELLALWVAAGYGVGLSAQSHIEHAHGWGISMRPLSDGPY
EIVTHLQRPHGPANSVSERFERRALQIAKAGAA
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcacgacgccacaaaccggttgtcccatttcaagctcgcgatagcgcctggtgtgccg
tcatcacgtctctctaagctgcttgcgctgcagcgcgcggaggaaccggaagtcaccatc
gcgtttttcgaggtcacggcggacgatctggtggcagggcttcgtgaaggccgttacgac
gcagggatgtcgcttcagggcttggccgatccatccctgagcagtcagcccctgtggagc
gaaagcatggccgttgccctgccgttgcggctccctttgctggatcaggcaacgctcaca
attgccgggttgcaggactacatggtgtttcgctggcaagcagaggcctgtcccttactg
gatcagaggttgtcctccttcctaccggaagaccaacggaacattcggtacatgacttcg
ttcgagctgctggctctatgggtggcggcgggctatggcgtcggcttatccgcgcaatcg
cacatcgagcatgctcatggatggggaatcagcatgcgaccactctctgatggtccctac
gaaatcgtgacgcacctgcagcgtccccacgggccagccaattctgtttctgagcggttc
gagcgcagagcactgcagattgccaaggctggcgcagcctga

DBGET integrated database retrieval system