KEGG   Tolumonas auensis: Tola_2486
Entry
Tola_2486         CDS       T00904                                 

Definition
(GenBank) integrase family protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Phage_integrase Arm-DNA-bind_3 Phage_int_SAM_3
Other DBs
NCBI-ProteinID: ACQ94080
UniProt: C4LAA5
Position
complement(2716714..2718645)
AA seq 643 aa
MALSDLTVRQAKAADKTYSIPDTDGLGLVVAPTSGKSWHLRYYWLGKQKRISLGNYPEIG
LREARALRDEARALLAKGINPHTDRKQKRHAVKLASDYTFKAVFDAWVEHRRKELKEGRQ
STLSQILRIFDKDVLPSLGRMSIYDIRRPQLLGVLARIEQRKAFTTAEKVRTWLGQLFRY
ALVIVEGMETNPATDLDVVAEPKPPVNHNPYLHLPELPEFLQKLRLYNPRGWQTQLGIRL
LFLTGVRTGELRLATPDQFDLDRGLWIIPPQIVKQLQDEMRKAGKRPQDVPPYIVPLSLQ
AIEILRYLLGVMRPAQQYLLTHRSDLKKRISENTLNAALKRMGYEDQLTGHGIRGTISTA
LNEIGYPKIWVDAQLSHSDPNKVSSAYNHAKYVEPRRRMMQDWADRLDLLEQGQVEAASA
HLTIHIEGVPAMVEAEDAAAIVEASPAVPVPPVVATPIIVTPNTAGATFQRLSQVPPPPT
RTPEPEVSAIQREREEMLAIYESPNNLPVPLFGKLAGKSKDQINRELKAGKLLSISLGNR
GQRVPDWQLVPLKHKLALVLMNQCPEADSWELYRMLTRPHPDLGDRAAIDVVTPTNLVAV
VRTIAGDQQHADAPETVSPRPIPEQVRQSVRRLVDSTVVLEGA
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggcactctctgatctgactgtgcggcaagctaaggccgccgacaaaacctacagcatc
cccgacaccgacggcctcggcctggtggtcgcccctaccagcggcaagtcgtggcacctg
cgctactactggctcggcaaacaaaagcgcatctccctgggcaactacccggagatcggc
ctgcgcgaggctcgtgccctgcgcgacgaggcccgggcgctgctggccaagggcatcaac
ccccacaccgaccgcaagcagaaacggcatgcggtcaaactggcttccgattacaccttc
aaggcggtcttcgacgcctgggtcgagcatcgccgcaaggaactcaaggaaggtcggcaa
agcacgctctcccagatcctccgtatcttcgacaaggacgtgctgcccagccttgggagg
atgtcgatctacgacattcgccggccccagcttctgggtgtcctggcaaggatcgagcag
cgcaaggccttcactaccgctgaaaaggtccgcacctggctgggacaattgttccgctat
gctctggtcattgtcgagggtatggaaaccaatccggctacggacctggacgtggtggcg
gagcccaaaccgccggtgaaccataacccttacctgcatctgcccgagcttcccgaattt
ctccagaagctcaggctctacaaccctcgcggctggcaaacccagctcggcatccggctg
ctgttcctgaccggggtgcgcaccggcgaactgcggctggcgaccccggatcagttcgac
ctcgaccgtggtctgtggatcatcccgccgcagatcgtcaagcagcttcaggacgagatg
cgcaaggccggcaagcgcccgcaggatgtgccgccctacatcgtgccgctgtccctccag
gccatcgagatcttgcgctacctcctgggggtgatgcggccggcccagcagtacctgctg
acgcatcgcagcgacctcaagaagcgcatcagcgagaacaccctcaacgccgccttgaaa
cggatgggctacgaggatcaactgaccggccacggcatccgcggaaccatctctacggcg
ctcaacgagatcggctaccccaagatttgggtggacgcgcagctttcgcactccgacccg
aacaaggtgagttcggcctacaaccacgccaagtatgtggagccgcgccgccggatgatg
caggactgggccgaccgcctcgacctgctcgaacagggccaggtggaggctgcgagcgcg
catctcaccatccatatcgaaggggtgccggcaatggtagaagcggaagatgccgctgcc
atcgtcgaggcttcccctgcagtccccgtcccgcctgtggtggctactcccatcatcgtg
acgccgaacaccgccggggccacgttccagcggctgtcgcaagtgcctccgccccccacc
cggacgccagagccggaagtgtccgcgatccagcgcgagcgcgaggaaatgctcgccatc
tacgaatcgccgaacaaccttccggttcctctgttcggcaagctggccgggaagtccaag
gaccagatcaaccgcgagttgaaggcgggcaagctgctgtccatcagtctaggcaaccgg
gggcagcgtgttcccgattggcaattggtgccgctcaagcacaagctggctctggtgctc
atgaaccagtgcccggaagcggactcctgggagctttaccgcatgctgacccggccacac
ccggatttgggggatcgcgcggccatcgatgtggtgacaccgaccaatctggtcgcagtc
gtccgaaccatcgcgggcgatcagcagcatgcagatgcccccgagactgtctcgccgcgg
cctatccccgaacaggtgcggcagagtgtccgccggttggtggatagcaccgtggtgctt
gaaggggcttga

DBGET integrated database retrieval system