KEGG   Tolumonas auensis: Tola_2487
Entry
Tola_2487         CDS       T00904                                 

Definition
(GenBank) Exonuclease RNase T and DNA polymerase III
  KO
K13288  oligoribonuclease [EC:3.1.-.-]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tau03019]
    Tola_2487
   03009 Ribosome biogenesis [BR:tau03009]
    Tola_2487
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Tola_2487
Messenger RNA biogenesis [BR:tau03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Tola_2487
Ribosome biogenesis [BR:tau03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    Tola_2487
SSDB
Motif
Pfam: RNase_T
Other DBs
NCBI-ProteinID: ACQ94081
UniProt: C4LAA6
Position
complement(2719255..2719800)
AA seq 181 aa
MSQNEQNLIWLDMEMTGLEPETDRILEIAMIVTDKELNVLAEGPVLAIHQSDDVLAGMDE
WNTRTHGESGLVDRVRASECDEAKAVATCLTFIREWVPEGKSPMCGNSIGQDRRFMVRYM
PELEKYFHYRNIDVSTIKELVSRWKPEIMDEFTKTGTHQALDDIRESIAEMQFYRKRVFT
I
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagccaaaatgaacagaatctgatctggttagacatggaaatgaccggtctggaacca
gaaacagaccgtattctggaaatagccatgattgtcacggacaaagaactgaatgtgctc
gcagaaggaccggtactggcgatccatcagtcggatgatgtattagcaggaatggatgag
tggaatacccgtacgcatggtgagtcaggcctggttgatcgtgttcgtgccagtgaatgc
gatgaggcaaaggcggtagccacttgtctgacgttcatccgggaatgggtacctgaaggc
aaatcaccaatgtgtggtaacagcatagggcaggaccgccgttttatggtgcgctatatg
cccgagctggagaaatactttcattaccgcaacattgatgtcagcacgattaaagagctg
gtgagtcgctggaaaccggaaattatggatgaatttaccaaaaccggcacccatcaggca
ctggacgatattcgcgagtcaattgcggaaatgcagttctatcgtaagcgggtgtttaca
atttaa

DBGET integrated database retrieval system