KEGG   Tolumonas auensis: Tola_2489
Entry
Tola_2489         CDS       T00904                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
tau  Tolumonas auensis
Pathway
tau00564  Glycerophospholipid metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Module
tau_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tola_2489
Enzymes [BR:tau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Tola_2489
SSDB
Motif
Pfam: PS_Dcarbxylase
Other DBs
NCBI-ProteinID: ACQ94083
UniProt: C4LAA8
Position
2720985..2721860
AA seq 291 aa
MKLLDMLKIATQYLLPKHAVSRLVGYLAAAEAGSLTTFLIKAFIKRFNINMSEAEFEDPA
HYKTFNAFFTRQLKPGLRPVVAEEDSVALPVDGCISQLGDIKHGRIIQAKRHDFSARELL
GGDKDLSEQFQNGKFATIYLSPRDYHRIHMPLDGELQSMVYIPGDLFSVNPLTAQNVPNL
FARNERVACVFKTPYGPMALVLVGATIVASIETVWSGTVTPPTGKMVKRWDFHGNTPITL
KKGEEMGLFKLGSTVVCLFPPEMLEFAGHLQADTETRMGEIFAKLNNSPTV
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaattgctggatatgctgaaaatagcaacccaatatctgttaccgaaacatgcggtg
tcccgactggttggttatctggcggcggctgaggccggctcgctgactactttcctgatc
aaagcattcatcaaacgttttaatatcaacatgagtgaagccgaattcgaagatccggct
cactataaaacctttaatgctttctttacccgtcagctaaaaccaggcttgcgtcctgtt
gtcgccgaagaagattctgtcgctttacccgtcgatggttgcattagtcaattgggtgat
attaaacacggccgtataattcaggctaaacgccatgatttcagtgcacgggaattactg
ggcggtgataaagatctgtctgagcaatttcagaacggtaaatttgccactatttatctg
tccccgcgcgattaccaccgcatccatatgccgctggacggcgaactgcaaagcatggtg
tatattccgggcgacctgttttcagttaatccgctgacggcacagaatgttccaaatctg
tttgcccgtaatgaacgtgtcgcctgtgtatttaaaacaccttatggtccgatggcgttg
gtactggtaggtgcaacgatcgtagccagcatcgaaaccgtctggtcaggcactgttacc
ccgccaaccgggaaaatggtgaaacgctgggatttccatgggaatacaccgatcaccctg
aaaaaaggtgaagaaatggggctgttcaaactgggcagtactgtggtttgtctgttcccg
ccagagatgctggaatttgccgggcatctgcaggctgacactgaaacccgcatgggtgaa
atatttgccaagctgaacaactcaccaacagtataa

DBGET integrated database retrieval system