KEGG   Tolumonas auensis: Tola_2490
Entry
Tola_2490         CDS       T00904                                 

Definition
(GenBank) fumarate reductase, flavoprotein subunit
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00190  Oxidative phosphorylation
tau00620  Pyruvate metabolism
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau02020  Two-component system
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tau_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2490
   00620 Pyruvate metabolism
    Tola_2490
   00650 Butanoate metabolism
    Tola_2490
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tola_2490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2490
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Tola_2490
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO
Other DBs
NCBI-ProteinID: ACQ94084
UniProt: C4LAA9
Position
2722212..2723981
AA seq 589 aa
MDIIKTDVAIVGAGGGGLRAAIAIAEKNPELEIALISKVYPMRSHTVAAEGGAAGVVRDD
DSLENHFHDTVSGGDWLCEQDVVEYFVENATKELVQMEHWGCPWSRKEDGHVNVRAFGGM
KIPRTWFAADKTGFHMLHTLFQTSIKYPSIKRFDEHFVLDLLVHDGRPQGVVCFDIQNGV
TRIIQAKSVIIATGGGSRVYRFNTNGGIVTGDGMALAYRHGVPLRDMEFVQYHPTGLPGS
GILMTEGCRGEGGILLNKDGYRYLQDYGLGPEIPVGETKNKYMELGPRDRLSQAFWQEQQ
RGRTIESPFGDIVHLDLRHLGEKKLLERLPFICELSRAYMGVDPVKEPIPVRPVVHYTMG
GIETDCMGATRMPGLFAVGECASNGLHGANRLGSNSLCEIVVFGKVAGEQAALFAKQHSH
IDSNILYRQGMEVVAKSMSLMENGGTENPADIRNEMGDAMESGVGIYRTAETMQNTIDKL
KELKERYKRVRVADKSSVFNTDWLYTIELGFLLDVAESVAHSAIQRKESRGSHQRIDGYE
ERDDVNYLKHSLAFRNENGAPTIEYSDVKITKSQPAKRVYGSEAEKGAK
NT seq 1770 nt   +upstreamnt  +downstreamnt
gtggacattatcaagaccgatgtcgcgattgtcggagcaggaggcggtggattacgagct
gcgattgcaattgcagaaaaaaatcccgagctggaaatagccctgatatctaaagtttat
ccgatgcgcagtcatactgttgcagctgaaggtggtgctgcaggtgtggttcgtgatgat
gacagtctcgaaaaccatttccacgatacggtttctggtggtgactggctgtgtgagcag
gatgtcgtcgaatacttcgtggaaaatgcaaccaaagaactggtgcagatggaacactgg
ggttgcccgtggagcagaaaagaggacggacatgttaacgtgcgtgcctttggtggaatg
aagattccccggacctggtttgctgcggataaaaccggcttccacatgctgcacacgctg
ttccagacctccattaaatacccgtcgatcaaacgttttgatgaacatttcgtactcgat
ttgttagtacatgatggtcgtccgcagggtgtggtctgtttcgacattcaaaatggtgtg
actcgtattatccaagcgaaatccgtcattattgcaaccggtggtggcagccgcgtttat
cgcttcaacaccaatggtggcattgttaccggtgatggtatggcactggcttaccgtcat
ggtgtaccactgcgcgatatggaattcgttcagtatcatccaaccggcttacccggctcg
ggtattctgatgaccgaaggctgtcgtggtgaaggcggcattctgctgaacaaagacggt
taccgttatctgcaggattatggtttaggcccggaaattccggtcggtgaaaccaaaaac
aaatacatggagttaggtccacgcgaccgtttgtctcaagccttctggcaggaacaacaa
cgcggccgcacgatagaatcgccattcggtgatatcgtgcatctggatctgcgccatctc
ggcgagaagaaactgctggaacgtctgccattcatttgcgagctgtctcgagcctatatg
ggcgttgatccggttaaagagccgatcccggttcgccccgtggttcactacaccatgggc
ggtatcgaaactgactgcatgggcgcaacccgcatgccgggtctgtttgccgttggcgaa
tgtgcgtcgaatggtctgcatggcgctaaccgtttaggctcaaactccctgtgtgaaatt
gtggtattcggtaaagtcgccggtgaacaagcagccttgtttgccaaacaacatagtcat
atcgacagcaacattctttatcgccagggtatggaagtcgttgcaaaatcgatgtctctg
atggaaaacggtggcacagaaaacccggcggatatccgcaatgagatgggtgatgccatg
gaaagcggcgtgggtatctaccgtaccgctgaaacaatgcaaaacaccattgataagctg
aaagagctgaaagagcgctataaacgcgttcgtgtggcggataaatcatcggtctttaac
accgactggctctacaccatcgaattaggtttcctgcttgatgtggcagaatccgtggcg
cattccgccattcaacggaaagaatcacgcggttcacaccagcgcattgatggttatgaa
gagcgtgatgatgtgaattatctgaaacactcattggctttccgcaatgaaaatggtgct
ccgaccattgagtacagtgatgtcaaaattaccaagtcacagccagcaaaacgcgtgtat
ggctcagaagcagagaaaggagcgaaataa

DBGET integrated database retrieval system