KEGG   Tolumonas auensis: Tola_2491
Entry
Tola_2491         CDS       T00904                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00245  fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00190  Oxidative phosphorylation
tau00620  Pyruvate metabolism
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau02020  Two-component system
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tau_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2491
   00620 Pyruvate metabolism
    Tola_2491
   00650 Butanoate metabolism
    Tola_2491
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tola_2491
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2491
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Tola_2491
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_17 Fer4_9 Fer4_16 Fer4_18 Fer4 Fer4_6 Fer4_4 Fer4_2 Fer2 Fer4_13 Fer4_3 Fer4_21 Fer4_22
Other DBs
NCBI-ProteinID: ACQ94085
UniProt: C4LAB0
Position
2723981..2724721
AA seq 246 aa
MAEIMEIEVLRYRPEEDNEPWTQRYQVPFTHEMSILEALTHIKDHIDSTLSYRWSCRMAI
CGSCGMMVNGKPKLGCKTFLRDYISEGKIRLEPLANFPIERDLVVDMSDFMQKLEKIKPY
IIPKEEKNLCDGEYLQTPKQLAQYKQFSQCINCGLCYAACPQYALKPEFLGPAAIALLYR
YNEDSRDGAKEERMKLIHQESGVWSCTFVGFCSEVCPKGVDPAAAIQLYKAESAKDYVIA
MFKPED
NT seq 741 nt   +upstreamnt  +downstreamnt
atggctgagatcatggagattgaagtattacggtatcgtcctgaagaggataacgaaccg
tggacccagcgttatcaggtgccgtttacccatgaaatgtcgatcctggaagcactgaca
catatcaaggatcacattgactcaaccctgagttaccgctggtcttgccgcatggccatt
tgtggctcttgcggcatgatggtgaatggtaagccaaaactgggctgcaaaaccttcctg
cgtgattacatcagtgaaggcaaaattcgcctggaaccactggcaaatttccctatcgag
cgcgatctcgtggtggatatgtccgatttcatgcagaaattggaaaaaattaagccttac
atcatcccgaaagaagaaaaaaatctttgcgatggtgaatacctgcagacgccaaaacag
ctcgcgcaatacaagcaattctcacagtgcattaactgtggtttgtgttacgccgcctgc
ccacagtatgcactgaaaccggaattcctcggcccggctgcgattgccctgctctatcgt
tacaacgaagacagtcgtgatggtgccaaggaagagagaatgaaactcatacatcaggaa
tccggcgtctggagctgcacttttgtcggtttctgttctgaagtttgtccgaaaggcgtc
gatcctgctgcggctattcagctctacaaggcagaaagcgcgaaagattacgtcatcgct
atgtttaagccggaggactaa

DBGET integrated database retrieval system