KEGG   Tolumonas auensis: Tola_2492
Entry
Tola_2492         CDS       T00904                                 

Definition
(GenBank) fumarate reductase subunit C
  KO
K00246  fumarate reductase subunit C
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00190  Oxidative phosphorylation
tau00620  Pyruvate metabolism
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau02020  Two-component system
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tau_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2492
   00620 Pyruvate metabolism
    Tola_2492
   00650 Butanoate metabolism
    Tola_2492
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tola_2492
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2492
SSDB
Motif
Pfam: Fumarate_red_C Sdh_cyt 7tm_7
Other DBs
NCBI-ProteinID: ACQ94086
UniProt: C4LAB1
Position
2724724..2725128
AA seq 134 aa
MDMSQSKRKPYVRQVKKSWWLRNSFYTGYMLREGTCIFVGAYAVVLLCGLLRLTQGPEAF
AGWLTALQSPLAIVFHLLALVACLFHAKTWFSLAPKAVRIFKGEELLPEKPIIMAQYIGL
AAVSVIVLLIAVLA
NT seq 405 nt   +upstreamnt  +downstreamnt
atggatatgtcacaaagcaaacgtaaaccgtatgtccgtcaggttaaaaagagctggtgg
ttacgtaacagtttttatactggttacatgctgcgtgaaggtacctgcatttttgtcggt
gcttatgctgtcgttctgctctgcggcctgttacgtctgactcagggaccggaagctttc
gctggctggctgactgcgttacaaagcccattggcgattgtgtttcatctgctcgccctg
gtggcatgtcttttccatgccaagacctggttctcgctggcaccgaaagcagttcggatc
ttcaaaggcgaagagctgttgccggaaaaaccaatcattatggcgcaatacattggtctg
gcagcagtcagcgtgattgtattgctcatcgctgttctggcctga

DBGET integrated database retrieval system