KEGG   Tolumonas auensis: Tola_2493
Entry
Tola_2493         CDS       T00904                                 

Definition
(GenBank) fumarate reductase D subunit
  KO
K00247  fumarate reductase subunit D
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00190  Oxidative phosphorylation
tau00620  Pyruvate metabolism
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
tau02020  Two-component system
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tau_M00150  Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2493
   00620 Pyruvate metabolism
    Tola_2493
   00650 Butanoate metabolism
    Tola_2493
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tola_2493
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tola_2493
SSDB
Motif
Pfam: Fumarate_red_D DUF5389 Sdh_cyt PHO4
Other DBs
NCBI-ProteinID: ACQ94087
UniProt: C4LAB2
Position
2725143..2725493
AA seq 116 aa
MKRSDEPIYWLLFGAGGVVAAVLLPVLILISGLMVPLGILDADTLSYEKMHALATSWWGA
PILLAVIALPIYHAMHRIYHGLHDLGIHPTKFLHYLLYGFAFLVSVAALTLLVQIH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaacgttctgatgaacccatttactggttattgtttggtgccggtggcgtcgttgct
gcagtgctactgcctgtgctgatcctgatctctggtctgatggtaccgctgggcatactt
gatgccgacacactgagctacgagaaaatgcatgcactggcgacttcatggtggggagcc
cccattctgttagccgttattgccttacctatctaccatgcgatgcaccgcatttatcat
ggattgcatgatttgggcattcaccctaccaaatttctgcattacctgctctatggcttt
gcgtttctggtatctgtggccgcgttaacactactggtacagatccattaa

DBGET integrated database retrieval system