KEGG   Tolumonas auensis: Tola_2494
Entry
Tola_2494         CDS       T00904                                 

Definition
(GenBank) guanosine monophosphate reductase
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
tau  Tolumonas auensis
Pathway
tau00230  Purine metabolism
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Tola_2494
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     Tola_2494
SSDB
Motif
Pfam: IMPDH Aldolase FMN_dh
Other DBs
NCBI-ProteinID: ACQ94088
UniProt: C4LAB3
Position
2725604..2726647
AA seq 347 aa
MRIEEDLKLGFKDVLFRPKRSTLSSRSQVELHREFRFRHTQTSWRGVPIIAANMDTVGTF
AMAKALASFDVMTAIHKHYTEQEWQTFVQNSSDPLLQYCMVSTGTSNNDFLKLQRILALS
PALRFICVDVANGYSEHFADFVKIVRETFPQHVICAGNVVTGEMVEELILSGADIVKVGI
GPGSVCTTRVKTGVGYPQLSAIIECADAAHGLGGQIVGDGGCTCPGDVAKAFGGGADFVM
LGGMLAAHEESGGNKFERDGKTFMRFYGMSSSTAMEQHAGGIAHYRASEGKTVELPFRGP
VSATIQDILGGVRSTCTYVGAAKLKELTKRTTFIRVSEQENPVYGQE
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcgtatcgaagaagatctgaaactcggttttaaggatgtcctgttccgcccgaaacgc
tctactctgagcagccgctcccaagttgaattacaccgtgaattccgtttccgacatacc
cagaccagctggcgaggtgtaccgatcatcgccgccaatatggataccgtgggaacgttt
gccatggccaaagcactggccagcttcgatgtcatgacagcgattcacaaacattatact
gaacaggaatggcagactttcgtacaaaacagcagtgatcctttattgcagtattgtatg
gtttctaccggcacatcgaataatgacttcctgaagctgcaacgcattctggcgttatca
cctgctttgcgttttatttgcgtcgatgtagccaatggttactctgagcatttcgctgac
tttgtgaaaatagtccgtgaaactttcccgcaacatgttatttgtgccggtaatgtcgtc
accggggaaatggtggaagagctgatcctgtccggtgctgatattgtcaaagttggtatc
ggtccgggttcagtttgtacaacccgcgttaaaaccggtgtgggctatccgcaactttcc
gccattatcgaatgtgccgatgccgcgcatggtctgggcgggcagattgtgggtgatggc
ggctgtacctgccccggggatgtagccaaagcattcggtggtggtgcggattttgtgatg
ctgggtggcatgctggcagcacatgaagagtccggcggtaacaaattcgagcgcgacggg
aaaacgttcatgcgcttttacggcatgagttcatccaccgcgatggaacaacacgctggc
ggtattgcgcattaccgggcttcagaaggaaaaaccgttgaactgcctttccgtggaccg
gtatccgctaccattcaggatattctgggtggtgtccgttctacctgcacttatgtcggc
gcagccaagcttaaagaactgaccaaacgcacgacttttattcgtgtcagtgaacaggaa
aatccggtttacggacaggaataa

DBGET integrated database retrieval system