KEGG   Tolumonas auensis: Tola_2495
Entry
Tola_2495         CDS       T00904                                 

Definition
(GenBank) Auxin Efflux Carrier
  KO
K24180  malate permease and related proteins
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tau02000]
    Tola_2495
Transporters [BR:tau02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Tola_2495
SSDB
Motif
Pfam: Mem_trans SBF
Other DBs
NCBI-ProteinID: ACQ94089
UniProt: C4LAB4
Position
complement(2726677..2727594)
AA seq 305 aa
MQTVSFLFFNIILPIFIPIIAGYLLQRKFPLNVATLTKIQFYIFIPALLFTTIYQTELNS
ALLRDLILANLVLFVLLWAVCLICARLMKLDAGKRSAFINSVCFYNSGNYCIPLIQLMYH
TPFAFSIQIIVMLIQQLLTNTVGVMNTSSANRSWKGALLENFRMPMTYAVLIALLCRWLS
IDVPKPLWTSFELMAQGLVPTALITLGAQLASTHLYLRNFRVLVSNAMRLLVGPLLAAAV
CWMWGISGVVAQVMVICAAAPSAVNTVLLAIEYRSDPEFASQTVFLSTLLSALTMPVVIA
LVQYL
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcaaacagtcagtttcttgttttttaatattatcctgccgatttttatcccaatcatt
gctggttatctgctgcaacggaagtttccgcttaatgttgctacgctgaccaagatccag
ttttatatttttattccggccttgctgtttactaccatctatcaaacggaattgaatagt
gcattattacgggatctgatcctcgctaatctggtgttgtttgttttattgtgggcagtt
tgtcttatctgtgcccgtttgatgaaactggatgcgggtaaacgtagtgcatttatcaat
tctgtttgtttctataacagtggtaattactgtattccattaattcagctgatgtatcac
acaccgtttgccttctcgatacagatcatcgtgatgctgatccagcagttgctgacgaat
acggtaggggtgatgaataccagcagtgccaaccgttcctggaaaggcgcattgctggaa
aacttccgcatgcccatgacctatgcggtactgattgcactgctgtgtcgctggctgagt
attgatgtgccgaagccactctggacctcttttgaattgatggcgcaagggctggtgcct
acggcactgatcaccttaggggcgcaattagccagcacgcatctctatctgcggaatttc
cgggtgttagtgtctaacgctatgcgcttactggtgggacctctgctggcggctgcagtt
tgctggatgtgggggatcagtggggttgtggctcaggtaatggtgatttgtgccgcagca
ccatcagcggtaaataccgtattgctggccatcgaatatcgttcagatccggaattcgcc
tcacaaacggtgtttttatccaccttgctgagcgcattaaccatgccggtggttattgcg
ctggtacaatatctgtaa

DBGET integrated database retrieval system