KEGG   Tolumonas auensis: Tola_2496
Entry
Tola_2496         CDS       T00904                                 

Definition
(GenBank) radical activating enzyme
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
tau  Tolumonas auensis
Pathway
tau00790  Folate biosynthesis
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tola_2496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tau03016]
    Tola_2496
Enzymes [BR:tau01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     Tola_2496
Transfer RNA biogenesis [BR:tau03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Tola_2496
SSDB
Motif
Pfam: Fer4_14 Radical_SAM Fer4_12
Other DBs
NCBI-ProteinID: ACQ94090
UniProt: C4LAB5
Position
complement(2727678..2728355)
AA seq 225 aa
MMSNHYPINEIFQSIQGEGFFSGVPAIFVRLQGCKVGCSWCDTKHSWELDADNLIPVRQL
FTDKKPKAGWSWLSPEEILSCFSAEEYTARHVVITGGEPCEYDLMVLSQTLIAHGYRVQI
ETSGTQPVQADDACWVTVSPKINMAGGYDVLPDVLLRANEIKHPVATAKHIAQLDALLAG
IDTSEKVICLQPISQKSRATELAMKICIQRNWRLSVQLHKYLDIE
NT seq 678 nt   +upstreamnt  +downstreamnt
atgatgagtaaccattatcccatcaatgaaattttccagagcatccagggcgaaggcttc
ttctcgggtgttccggcgatttttgtccgtctgcaaggctgcaaagtaggttgttcatgg
tgtgacaccaaacattcatgggaattggatgctgataacctcatccctgtccggcaatta
tttactgataaaaaaccgaaagctggctggagctggcttagcccggaagagatcctttct
tgtttttctgctgaagaatacacagccagacatgttgtaatcacgggtggtgaaccttgt
gaatatgacctgatggtgttgtcacaaacactgatagcacatggttatcgtgttcagatc
gaaaccagtggtacacaacctgttcaggctgatgatgcgtgctgggttactgtatcaccc
aaaattaatatggctggcggttacgatgtattacccgatgtattgctcagagcgaatgaa
attaaacatccggtcgcaacagcaaaacatattgcacagttggatgccttgttagccgga
attgatacttcagaaaaagtgatctgtttacaaccgattagtcagaagagccgtgctaca
gaattagcgatgaaaatctgtattcaacggaactggcgtttatctgtgcaattacataaa
tatcttgatatcgaataa

DBGET integrated database retrieval system