KEGG   Tolumonas auensis: Tola_2497
Entry
Tola_2497         CDS       T00904                                 

Definition
(GenBank) ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
tau  Tolumonas auensis
Pathway
tau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tola_2497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tau03011]
    Tola_2497
Ribosome [BR:tau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tola_2497
  Bacteria
    Tola_2497
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N DUF3672
Other DBs
NCBI-ProteinID: ACQ94091
UniProt: C4LAB6
Position
complement(2728427..2728876)
AA seq 149 aa
MEVILLDKIAHLGDLGDKVVVKSGFARNYLFPQGKAVMATKDNLAAFEARRAELEAKLAD
VLAAAEARAAQLSALTNVTIATKAGDEGKLFGSVGTRDIADAITAAGVPVAKSEVRMPNG
VLRSVGEYDIVVHLHTDVNTTVKVTVVAE
NT seq 450 nt   +upstreamnt  +downstreamnt
atggaagttattctgttagacaaaatcgctcatctgggcgatctgggtgacaaagttgtt
gttaagagcggttttgctcgtaactatttgttcccgcaaggcaaagctgtaatggctact
aaagacaacctggctgctttcgaagctcgccgcgctgaactggaagctaaactggctgac
gttctggctgctgctgaagctcgtgctgctcagttgtctgcactgaccaacgtaactatc
gctaccaaagctggtgacgaaggtaaactgtttggttcagttggtacccgtgatatcgct
gatgcgatcactgctgccggtgttccagttgctaagagcgaagttcgcatgccgaacggt
gttctgcgcagcgttggtgaatacgacatcgttgttcacctgcacactgatgtaaacacc
actgttaaagtgactgttgttgctgaataa

DBGET integrated database retrieval system