KEGG   Tolumonas auensis: Tola_2498
Entry
Tola_2498         CDS       T00904                                 

Definition
(GenBank) ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
tau  Tolumonas auensis
Pathway
tau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tola_2498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tau03011]
    Tola_2498
Ribosome [BR:tau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Tola_2498
  Bacteria
    Tola_2498
SSDB
Motif
Pfam: Ribosomal_S18 HhH-GPD
Other DBs
NCBI-ProteinID: ACQ94092
UniProt: C4LAB7
Position
complement(2728916..2729146)
AA seq 76 aa
MSRFFRRRKFCRFTAERVTEIDYKDTVTLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLALLPYTDLHNK
NT seq 231 nt   +upstreamnt  +downstreamnt
atgtcacgttttttccgtcgtcgtaagttctgccgtttcactgctgaacgtgtaaccgag
atcgattacaaagataccgttactctgaaaaactacatcactgaatctggcaagatcgta
ccaagccgtatcactggtacccgtgctaaatatcagcgtcaactggcacgtgccatcaaa
cgtgctcgttacctggctctgctgccgtataccgatctgcataacaagtaa

DBGET integrated database retrieval system