KEGG   Tolumonas auensis: Tola_2499
Entry
Tola_2499         CDS       T00904                                 

Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
tau  Tolumonas auensis
Pathway
tau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tola_2499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tau03011]
    Tola_2499
   03029 Mitochondrial biogenesis [BR:tau03029]
    Tola_2499
Ribosome [BR:tau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Tola_2499
  Bacteria
    Tola_2499
Mitochondrial biogenesis [BR:tau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tola_2499
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: ACQ94093
UniProt: C4LAB8
Position
complement(2729174..2729548)
AA seq 124 aa
MRHYEIVFMVHPDQSEQVPGMIERYTGAIKAAGGTIHRLEDWGRRQLAYPIDKLHKAHYV
LMNVEAEQSVIDELENNFRFNDAVIRNMIMRTKHAVTEASPMLKAREERPRREDVREEAE
EAAE
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcgtcactacgaaatcgtattcatggttcatccggaccagagcgaacaggttccaggc
atgatcgaacgttacaccggtgctatcaaagctgctggtggtacaatccatcgtctggaa
gattggggtcgtcgtcaactggcttacccaatcgacaaactgcacaaagctcactatgtt
ctgatgaacgtagaagctgagcagagcgttatcgacgaactggaaaataacttccgtttc
aacgacgcggttatccgcaacatgatcatgcgcactaagcacgctgtgactgaagcatct
ccgatgctgaaagcacgtgaagagcgtccacgtcgtgaagatgtgcgtgaagaagctgaa
gaagctgctgaataa

DBGET integrated database retrieval system