KEGG   Tolumonas auensis: Tola_2500
Entry
Tola_2500         CDS       T00904                                 

Definition
(GenBank) peptide methionine sulfoxide reductase
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tola_2500
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     Tola_2500
SSDB
Motif
Pfam: PMSR
Other DBs
NCBI-ProteinID: ACQ94094
UniProt: C4LAB9
Position
2729717..2730358
AA seq 213 aa
MHTRTRMVAPDEALTGRETPMLTEPLHYVKQVSMFPPYPAGLEVAHFAMGCFWGAERLFW
IQPGVYVTAVGYQGGFTPNPTYDEVCSGATGHTESVRVVYDPAIISYATLLKLFWEQHDP
AEGARQGNDIGTQYRSMIFTRTEQQQQLAIQTLERYQAAMRTNNDARTITTEITQEKAFY
FAEQYHQQYLAKNPGGYCGLGGIGICLPEPDLS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcatacacgaacccgcatggtggctccggatgaagcattaacaggccgtgaaaccccc
atgctgaccgaacctttgcattatgtgaaacaagtcagcatgttcccaccctatccggcc
ggactggaggttgctcattttgcaatgggctgtttctggggagcagagcgattgttctgg
atacaaccgggggtctatgtgactgctgtcgggtatcagggcggctttacacctaaccca
acctatgacgaagtctgcagcggagctaccggtcataccgaaagtgtccgggtggtttat
gacccagcgattatcagttatgccactttactgaaattattctgggagcagcacgatccg
gcagaaggggcgcgtcagggtaatgatatcggcacacaatatcgctcgatgatttttacc
cggacagaacagcaacaacagctggcaatccagaccctggaacgttaccaggcggcgatg
cggacgaataatgatgccagaaccatcaccactgaaattacgcaggaaaaagcgttttat
tttgctgaacaatatcatcagcaatatctggctaaaaacccaggcggatattgtggtctg
ggaggaatcggaatttgtttaccggagccggatctatcctga

DBGET integrated database retrieval system