KEGG   Tolumonas auensis: Tola_2501
Entry
Tola_2501         CDS       T00904                                 

Definition
(GenBank) mannose-6-phosphate isomerase, class I
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
tau  Tolumonas auensis
Pathway
tau00051  Fructose and mannose metabolism
tau00520  Amino sugar and nucleotide sugar metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tola_2501
   00520 Amino sugar and nucleotide sugar metabolism
    Tola_2501
Enzymes [BR:tau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Tola_2501
SSDB
Motif
Pfam: PMI_typeI Cupin_2
Other DBs
NCBI-ProteinID: ACQ94095
UniProt: C4LAC0
Position
complement(2730411..2731610)
AA seq 399 aa
MSFSSNCIYRMQNPILNYAWGSKDAIQKMYGIANPEGKPQAEIWMGAHPTGCSALIDEQG
ETLRLDAFIKQDAAAILGDAQTNFGELPYLFKVLAAAEPLSIQVHPDKANSEAGFAAENA
AGVPLTAAHRNFKDPNHKPELVYALTPYRAMNGFREFAEIVALIKDLALPALQTEIDAFC
LQPTDSTLKALFAASLRLQGDIRRETVATLLATAQQRQDEAAFAEVLRLAGFYPEDMGLF
APLLLNVITLQPGEAMFLYARTPHAYLQGVGLEAMASSDNVLRAGLTPKHMDIDALLANV
DFVAKPASELLMRPMVLGPVSDYPIPVEDFSFTLVNLTQNLLESETSTALILFCVNGHAG
ITANGKTLTLQAGESCFVPAAVGGFAVSGEGQLVQIGSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgagtttttcctccaattgcatctaccggatgcagaacccgatcctgaattatgcctgg
ggcagtaaagatgctattcagaaaatgtatggcattgctaatccggaaggtaaaccacaa
gctgaaatctggatgggagcgcacccgaccggctgctctgctcttattgatgagcagggt
gaaaccctgcgtctggatgcgttcatcaaacaggatgcggcggctattctgggcgatgcg
caaacgaattttggcgaactgccgtatctgtttaaggtgctggctgcagcagagccttta
tcgatccaggttcatcctgacaaagctaactctgaagcaggttttgctgccgaaaacgcg
gctggtgtgccattaactgctgcacatcgcaatttcaaagacccgaatcataagccggaa
ctggtgtatgcgctgacgccttaccgggcgatgaatggtttccgtgaatttgccgaaata
gtggccttgattaaggatctggctttgcctgcactgcagacagagatcgatgcattttgt
ctgcagccgactgactctaccctgaaagccttgtttgcggcttctctgcgcttacagggc
gacattcgtcgtgaaaccgtggctaccttgctggcgactgctcaacagcgtcaggatgaa
gctgcgttcgcggaagtgctgcgtctggccgggttctatccggaagatatggggctgttt
gcaccgctactgctgaacgtgatcacgttgcagcccggggaagctatgttcctgtatgcg
cgtacgccgcatgcttatctgcaaggggtcggattagaggcgatggccagttccgataac
gtactccgtgcagggttaacaccaaaacacatggatattgatgcattactggcgaatgtc
gatttcgtggctaaaccagccagtgaattgctgatgcgtccgatggtattagggcctgtc
agtgattatccgatcccggtggaggacttttcttttacgctggttaatctgactcagaat
ttgctggaaagtgaaacgagtactgctctgatcctgttctgcgtaaatggtcatgccggg
atcactgccaatggtaagacgcttacattgcaggccggtgaatcctgttttgtccctgct
gccgtaggaggctttgctgtcagcggtgaaggccagttggtgcaaatcggctcccgctga

DBGET integrated database retrieval system