KEGG   Tolumonas auensis: Tola_2502
Entry
Tola_2502         CDS       T00904                                 

Definition
(GenBank) thiamine biosynthesis/tRNA modification protein ThiI
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Organism
tau  Tolumonas auensis
Pathway
tau00730  Thiamine metabolism
tau01100  Metabolic pathways
tau04122  Sulfur relay system
Module
tau_M00127  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/tyrosine) => TMP/TPP
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tola_2502
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Tola_2502
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tau03016]
    Tola_2502
Enzymes [BR:tau01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.4  tRNA uracil 4-sulfurtransferase
     Tola_2502
Transfer RNA biogenesis [BR:tau03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Tola_2502
SSDB
Motif
Pfam: ThiI THUMP QueC Rhodanese Diphthami_syn_2 tRNA_Me_trans
Other DBs
NCBI-ProteinID: ACQ94096
UniProt: C4LAC1
Position
complement(2731801..2733258)
AA seq 485 aa
MKFIIKLFPEITIKSKSVRQRMVKILQGNIRNVLQKVDETVTVRNDWDKLMVSSKNDSPE
NRDKLVERLSCMPGIQAFLEVTQVPFTDLHDIYEQTAAVYGPTLANKTFCVRVKRKGKHE
FTSIEIERYVGGGLNQNFPSNGVRLSHPDLQINLQIENELLYLVTAIHKGLGGYPLSTQE
DVLSLISGGFDSGVASYLFIKRGSRVHYCFFNLGGAAHEIGVKQVAYYLWSKYSQSHKVK
FVSVPFEPVVGEILEKIDNGLMGVVLKRMMMRAASRVAERMGVEALVTGESVGQVSSQTV
TNLSVIDRVTDTLILRPLIVSDKQDIIDQARAIGTQEFAETMPEYCGVISNKPTVKARYE
EVLANEAKFNFDVLENVITSAKVIDIREIANETEAQVQEVETTSALAENEVILDIRSPDE
HEDKPFNPEGMTVIHLPFYKLSTQFGDLDQSKTYLLYCERGVMSKLQALYLKEQGFNNIK
VYRQN
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaaattcatcattaaactgttcccggaaatcaccatcaaaagtaaatccgtccgccaa
cgcatggtgaaaattttgcagggtaatatccgtaatgtcctgcaaaaagtggatgagacc
gttactgtccgtaacgactgggacaagctcatggtgtccagtaaaaatgattcgcccgaa
aacagagacaagctggttgaacgtttgagttgcatgccgggtatccaggcttttctggaa
gtgacacaggtaccgttcactgatctgcacgatatttacgagcagactgcggcagtctat
ggcccgacgctggcaaataaaaccttctgtgtgcgtgtgaaacgcaaaggtaaacatgaa
ttcacctccatcgaaattgagcgttatgtcggtggcggactgaatcagaatttcccgtct
aatggagtcagactttcgcatccggatctgcagatcaatctgcagattgaaaatgagctg
ctgtatctggtcacggcgatccataaaggcttaggtggttatccgctgtcgacacaggaa
gatgtattaagtctgatctccggtggttttgactccggggtggcttcttatctgttcatc
aaacgtggcagccgagtgcactactgtttctttaatctgggcggcgcggcgcatgagatc
ggcgtgaaacaggtggcttattatctgtggagcaaatacagccagtcacacaaagtaaaa
tttgtttctgtgcctttcgaacccgtggttggcgagatcctggaaaaaatcgacaatggt
ctgatgggcgtggtactgaaacgaatgatgatgcgggcggcttcccgtgttgcggaacgt
atgggtgtcgaagcgttagtcaccggtgagagcgtcggacaggtatccagccagaccgtc
accaatctgtctgtgattgatcgtgttaccgacaccttgatcctgcgtccgctgatcgtc
agtgataagcaagacatcattgatcaggcccgggccatcggaactcaggagttcgctgaa
accatgccggaatattgcggagtgatttccaataagccgacggtaaaagcgcgttatgaa
gaagttttggcgaacgaagccaagtttaatttcgatgtactggaaaatgtgatcaccagt
gcgaaagtgatcgatatccgtgagatcgcgaatgaaaccgaagctcaggtgcaggaagta
gaaacgacatcggcactggctgaaaacgaagtcattctggatatccgttcaccggatgaa
cacgaagataagccgtttaatccggaaggcatgaccgtgatccatttaccgttttataag
ctgtcgactcagttcggcgatttggatcagagcaaaacctatctgttgtattgcgagcgc
ggcgtgatgagtaaattacaggcgctctatctgaaagagcagggctttaacaacattaaa
gtttatcgtcagaattaa

DBGET integrated database retrieval system