KEGG   Tolumonas auensis: Tola_2503
Entry
Tola_2503         CDS       T00904                                 

Definition
(GenBank) exodeoxyribonuclease VII, small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
tau  Tolumonas auensis
Pathway
tau03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Tola_2503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tau03400]
    Tola_2503
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Tola_2503
DNA repair and recombination proteins [BR:tau03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     Tola_2503
SSDB
Motif
Pfam: Exonuc_VII_S
Other DBs
NCBI-ProteinID: ACQ94097
UniProt: C4LAC2
Position
2733411..2733677
AA seq 88 aa
MAAKKTESLSFDAALGELEQIVQQLEQGDLPLETALKQFERGIQLARVSKQKLEQAEQQV
QILLQQGEQEKLTPFTVEQTSGQNAEEE
NT seq 267 nt   +upstreamnt  +downstreamnt
atggccgccaaaaagaccgaatcattaagttttgatgctgctctcggagagctggagcaa
attgtgcaacagctggaacagggtgatttaccgctggaaacagcactgaaacaatttgaa
cgaggcattcagctggcgcgggtgagcaaacaaaaattagaacaagcggaacagcaggtg
cagatactgttacaacagggtgagcaggaaaaactgacgccatttactgttgaacagaca
tccggccagaacgcagaggaagaataa

DBGET integrated database retrieval system