KEGG   Tolumonas auensis: Tola_2504
Entry
Tola_2504         CDS       T00904                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
tau  Tolumonas auensis
Pathway
tau00900  Terpenoid backbone biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tola_2504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:tau01006]
    Tola_2504
Enzymes [BR:tau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Tola_2504
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Tola_2504
Prenyltransferases [BR:tau01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Tola_2504
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: ACQ94098
UniProt: C4LAC3
Position
2733678..2734568
AA seq 296 aa
MSLQTFSQHYRQRIDDLLLQKIETLPDLSPRLKAAMRHGLVLGGKRVRPFLVYATGSMLD
IDEALLDGPAAAIECIHAYSLIHDDLPAMDDDDLRRGHPTVHKAFDEATAVLAGDALQTL
AFSILADHPFPDALRTQQVKMLSTLAQASGYAGMCGGQALDLAAEGQHVGLEALELIHRH
KTGALIECAVMLGALCQQDVAAETVSALKKYAAAIGLAFQVQDDILDVVSDTETLGKPQG
SDQALDKSTYPALLGLDAAREMAQDLHRQALAALAPLPYNTEILSAFADYIIERAY
NT seq 891 nt   +upstreamnt  +downstreamnt
gtgtcactgcagaccttttcacaacactaccggcaacgcattgatgatctgttgctgcaa
aaaatcgaaaccttacctgatttatcacctcgcctaaaagcggcaatgcgccatggcctg
gtgctgggtggcaaacgggttcgtccatttctcgtctatgctaccggtagcatgctggac
attgatgaagcattactggatggaccggccgccgcgatcgagtgcattcatgcctattcg
ctgatccacgatgatttgccggctatggacgatgatgatctgcgtcgcggtcatccgact
gtgcataaagcgtttgatgaagcgactgccgtactggcaggtgatgccttgcagacactg
gcattctctattctggcggatcaccctttcccggatgcattacgcacccagcaagtgaag
atgctgagcacgctggcacaagcttctggttatgccggcatgtgtggtggtcaggcgctg
gatctggccgcagaaggacaacatgtcggactggaagcactggagctgatccaccggcat
aagaccggcgcactgattgagtgtgcggtgatgctcggtgcattgtgtcagcaggatgtc
gcagcagaaacagtctctgccctgaaaaaatatgcagcggccatcggactcgctttccag
gtacaggatgacattcttgatgttgtcagtgataccgagacgctgggtaaacctcagggt
tctgatcaggcgctggataaaagcacctaccctgctttgctggggctggatgccgcccgc
gaaatggcgcaggatctgcaccggcaggcattagcggccttggcaccacttccttataat
actgaaatattatctgcgtttgctgattacatcatcgagcgcgcatattaa

DBGET integrated database retrieval system